Histone-lysine N-methyltransferase SETMAR

Chain: A
Length: 290 amino acids
Theoretical weight: 32.3 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: Q53H47 (Residues: 15-303; Coverage: 42%)
Gene name: SETMAR
FASTA Sequence
>pdb|3bo5|A
GAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSASKERLDHGKLRKPCYCGAKSCTAFLPFDSS
PDBe-KB: UniProt Coverage View: Q53H47