DEP domain-containing protein 1A

Chain: A
Length: 105 amino acids
Theoretical weight: 12.18 KDa
Source organism: Homo sapiens
Expression system: Not provided
UniProt:
  • Canonical: Q5TB30 (Residues: 11-108; Coverage: 12%)
Gene names: DEPDC1, DEPDC1A
FASTA Sequence
>pdb|2ysr|A
GSSGSSGYRATKLWNEVTTSFRAGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNNSNFGPEVTRQQTIQLLRKFLKNHVIEDIKGRWGSENVDDNNQLFRFPA