PDB 2nmx biological assemblies and structure analysis ‹ Protein Data Bank in Europe (PDBe)

Assemblies

Assembly 1

Download 3D Visualisation

Assembly Name: Carbonic anhydrase 1
hide full assembly name

Multimeric state: monomeric

Accessible surface area: 11207.26 Å²

Buried surface area: 641.1 Å²

Dissociation area: 284.04 Å²

Dissociation energy (ΔG^diss): 6.73 kcal/mol

Dissociation entropy (TΔS^diss): 3.54 kcal/mol

Symmetry number: 1

PDBe Complex ID: PDB-CPX-133680

$Monomeric assembly 1 of PDB entry 2nmx coloured by chemically distinct molecules, front view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>1 copy of Carbonic anhydrase 1;</li> <li class='image_legend_li'>1 copy of ZINC ION;</li> <li class='image_legend_li'>1 copy of N-{2-[4-(AMINOSULFONYL)PHENYL]ETHYL}ACETAMIDE;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

$Monomeric assembly 1 of PDB entry 2nmx coloured by chemically distinct molecules, side view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>1 copy of Carbonic anhydrase 1;</li> <li class='image_legend_li'>1 copy of ZINC ION;</li> <li class='image_legend_li'>1 copy of N-{2-[4-(AMINOSULFONYL)PHENYL]ETHYL}ACETAMIDE;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

$Monomeric assembly 1 of PDB entry 2nmx coloured by chemically distinct molecules, top view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>1 copy of Carbonic anhydrase 1;</li> <li class='image_legend_li'>1 copy of ZINC ION;</li> <li class='image_legend_li'>1 copy of N-{2-[4-(AMINOSULFONYL)PHENYL]ETHYL}ACETAMIDE;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

Assembly 2 (preferred)

Download 3D Visualisation

Assembly Name: Carbonic anhydrase 1
hide full assembly name

Multimeric state: monomeric

Accessible surface area: 11199.68 Å²

Buried surface area: 981.34 Å²

Dissociation area: 107.46 Å²

Dissociation energy (ΔG^diss): -2.24 kcal/mol

Dissociation entropy (TΔS^diss): 1.5 kcal/mol

Symmetry number: 1

PDBe Complex ID: PDB-CPX-133680

$Monomeric assembly 2 of PDB entry 2nmx coloured by chemically distinct molecules, front view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>1 copy of Carbonic anhydrase 1;</li> <li class='image_legend_li'>1 copy of ZINC ION;</li> <li class='image_legend_li'>1 copy of N-{2-[4-(AMINOSULFONYL)PHENYL]ETHYL}ACETAMIDE;</li> <li class='image_legend_li'>1 copy of SODIUM ION;</li> <li class='image_legend_li'>1 copy of 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

$Monomeric assembly 2 of PDB entry 2nmx coloured by chemically distinct molecules, side view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>1 copy of Carbonic anhydrase 1;</li> <li class='image_legend_li'>1 copy of ZINC ION;</li> <li class='image_legend_li'>1 copy of N-{2-[4-(AMINOSULFONYL)PHENYL]ETHYL}ACETAMIDE;</li> <li class='image_legend_li'>1 copy of SODIUM ION;</li> <li class='image_legend_li'>1 copy of 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

$Monomeric assembly 2 of PDB entry 2nmx coloured by chemically distinct molecules, top view. This structure contains: <ul class='image_legend_ul'><li class='image_legend_li'>1 copy of Carbonic anhydrase 1;</li> <li class='image_legend_li'>1 copy of ZINC ION;</li> <li class='image_legend_li'>1 copy of N-{2-[4-(AMINOSULFONYL)PHENYL]ETHYL}ACETAMIDE;</li> <li class='image_legend_li'>1 copy of SODIUM ION;</li> <li class='image_legend_li'>1 copy of 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL;</li> <li class='image_legend_li'>1 copy of water.</li></ul>}$

Macromolecules

Carbonic anhydrase 1

Chains: A, B
Length: 260 amino acids
Theoretical weight: 28.77 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:

Canonical: P00915 (Residues: 2-261; Coverage: 100%)

Gene name: CA1
Pfam: Eukaryotic-type carbonic anhydrase
InterPro:

Alpha carbonic anhydrase domain superfamily
Alpha carbonic anhydrase domain
Carbonic anhydrase, alpha-class
Carbonic anhydrase, alpha-class, conserved site

CATH: Alpha carbonic anhydrase
SCOP: Carbonic anhydrase

Carbonic anhydrase 1 in PDB entry 2nmx, assembly 2, front view.

Carbonic anhydrase 1 in PDB entry 2nmx, assembly 2, side view.

Carbonic anhydrase 1 in PDB entry 2nmx, assembly 2, top view.

FASTA Sequence


    >pdb|2nmx|A B

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

PDBe-KB: UniProt Coverage View: P00915

Molecule details ›

Download

FASTA (Protein chains A, B)
Archive mmCIF file
Updated mmCIF file
PDB file
PDB header
PDB file (gz)
PDBML
PDBML (ATOM lines)
PDBML (no atoms)
Structure Factors
SIFTS XML file with residue-level mappings

Search similar proteins

Similar 3D structures (PDBeFold)
Similar sequences

BLAST P00915 (UniProt)

Protein Data Bank in Europe

Structure of inhibitor binding to Carbonic Anhydrase I

Quick links

Assemblies

Assembly 1

Assembly 2 (preferred)

Macromolecules

Search similar proteins

Quick links

PDBe › 2nmx › Structure analysis

Structure of inhibitor binding to Carbonic Anhydrase I

Quick links

Assemblies

Assembly 1

Assembly 2 (preferred)

Macromolecules

Search similar proteins

Quick links

2nmx › Structure analysis