helicase nsP2

Chain: A
Length: 320 amino acids
Theoretical weight: 36.24 KDa
Source organism: Venezuelan equine encephalitis virus (strain TC-83)
Expression system: Escherichia coli
UniProt:
  • Canonical: Q9WIJ1 (Residues: 1003-1322; Coverage: 17%)
Gene name: NS
FASTA Sequence
>pdb|2hwk|A
DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS