TP53-binding protein 1

Chain: A
Length: 123 amino acids
Theoretical weight: 13.94 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: Q12888 (Residues: 1484-1603; Coverage: 6%)
Gene name: TP53BP1
FASTA Sequence
>pdb|2g3r|A
GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
PDBe-KB: UniProt Coverage View: Q12888