Zinc finger CCCH domain-containing protein 4

Chain: A
Length: 98 amino acids
Theoretical weight: 10.76 KDa
Source organism: Homo sapiens
Expression system: Not provided
UniProt:
  • Canonical: Q9UPT8 (Residues: 417-501; Coverage: 7%)
Gene names: C19orf7, KIAA1064, ZC3H4
FASTA Sequence
>pdb|2cqe|A
GSSGSSGELPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAGAEDEKEVEELKKSGPSSG