› › Negative modulator of initiation of replication

Negative modulator of initiation of replication in PDB entry 1xrx, assembly 2, front view.
Negative modulator of initiation of replication in PDB entry 1xrx, assembly 2, side view.
Negative modulator of initiation of replication in PDB entry 1xrx, assembly 2, top view.
Chains: A, B, C, D
Length: 50 amino acids
Theoretical weight: 5.7 KDa
Source organism: Escherichia coli
Expression system: Escherichia coli
UniProt:
  • Canonical: P0AFY8 (Residues: 1-50; Coverage: 28%)
Gene names: JW0674, b0687, seqA
FASTA Sequence
>pdb|1xrx|A B C D
MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSAASQPAAPVTKEVR
PDBe-KB: UniProt Coverage View: P0AFY8  

Quick links

Search similar proteins