› › Ubiquitin-like protein 5

PDB 1uh6 contains 1 copy of Ubiquitin-like protein 5 in assembly 1. This protein is highlighted and viewed from the front.
PDB 1uh6 contains 1 copy of Ubiquitin-like protein 5 in assembly 1. This protein is highlighted and viewed from the side.
PDB 1uh6 contains 1 copy of Ubiquitin-like protein 5 in assembly 1. This protein is highlighted and viewed from the top.
Chain: A
Length: 100 amino acids
Theoretical weight: 11.31 KDa
Source organism: Mus musculus
Expression system: Not provided
UniProt:
  • Canonical: Q9EPV8 (Residues: 1-73; Coverage: 100%)
Gene name: Ubl5
FASTA Sequence
>pdb|1uh6|A
MKGSSHHHHHHSSGASLVPRGSEGAATMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ

Visualisation

Quick links

Search similar proteins