Ubiquitin-like protein 5

Chain: A
Length: 100 amino acids
Theoretical weight: 11.31 KDa
Source organism: Mus musculus
Expression system: Not provided
UniProt:
  • Canonical: Q9EPV8 (Residues: 1-73; Coverage: 100%)
Gene name: Ubl5
FASTA Sequence
>pdb|1uh6|A
MKGSSHHHHHHSSGASLVPRGSEGAATMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ