Amyloid-beta A4 precursor protein-binding family A member 1

Chain: A
Length: 89 amino acids
Theoretical weight: 9.56 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: Q02410 (Residues: 655-741; Coverage: 10%)
Gene names: APBA1, MINT1, X11
FASTA Sequence
>pdb|1u38|A
EFKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVR