Regulatory protein cro

Chain: A
Length: 61 amino acids
Theoretical weight: 6.84 KDa
Source organism: Salmonella virus P22
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: P09964 (Residues: 1-61; Coverage: 100%)
Gene name: cro
FASTA Sequence
>pdb|1rzs|A
MYKKDVIDHFGTQRAVAKALGISDAAVSQWKEVIPEKDAYRLEIVTAGALKYQENAYRQAA