Proto-oncogene tyrosine-protein kinase Src

Chain: C
Length: 64 amino acids
Theoretical weight: 7 KDa
Source organism: Gallus gallus
Expression system: Escherichia coli
UniProt:
  • Canonical: P00523 (Residues: 77-140; Coverage: 12%)
Gene name: SRC
FASTA Sequence
>pdb|1rlp|C
GALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
PDBe-KB: UniProt Coverage View: P00523