› › Interferon-induced, double-stranded RNA-activated protein kinase

PDB 1qu6 contains 1 copy of Interferon-induced, double-stranded RNA-activated protein kinase in assembly 1. This protein is highlighted and viewed from the front.
PDB 1qu6 contains 1 copy of Interferon-induced, double-stranded RNA-activated protein kinase in assembly 1. This protein is highlighted and viewed from the side.
PDB 1qu6 contains 1 copy of Interferon-induced, double-stranded RNA-activated protein kinase in assembly 1. This protein is highlighted and viewed from the top.
Chain: A
Length: 179 amino acids
Theoretical weight: 19.71 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: P19525 (Residues: 1-170; Coverage: 31%)
Gene names: EIF2AK2, PKR, PRKR
FASTA Sequence
>pdb|1qu6|A
GSHMEMAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETGSGC

Visualisation

Quick links

Search similar proteins