Capsid protein G8P

Chains: A, B, C
Length: 46 amino acids
Theoretical weight: 4.61 KDa
Source organism: Pseudomonas virus Pf1
Expression system: Pseudomonas aeruginosa
UniProt:
  • Canonical: P03621 (Residues: 37-82; Coverage: 85%)
Gene name: VIII
FASTA Sequence
>pdb|1ql2|A B C
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA