Omega-agatoxin-Aa4a

Chain: A
Length: 48 amino acids
Theoretical weight: 5.22 KDa
Source organism: Agelenopsis aperta
Expression system: Not provided
UniProt:
  • Canonical: P30288 (Residues: 1-48; Coverage: 100%)
FASTA Sequence
>pdb|1oaw|A
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
PDBe-KB: UniProt Coverage View: P30288