Alpha-2-macroglobulin receptor-associated protein

Chain: A
Length: 81 amino acids
Theoretical weight: 9.54 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: P30533 (Residues: 51-131; Coverage: 25%)
Gene names: A2MRAP, LRPAP1
FASTA Sequence
>pdb|1lre|A
GEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDAR
PDBe-KB: UniProt Coverage View: P30533