Rubredoxin

Chain: A
Length: 53 amino acids
Theoretical weight: 5.86 KDa
Source organism: Pyrococcus furiosus
Expression system: Escherichia coli
UniProt:
  • Canonical: P24297 (Residues: 2-54; Coverage: 98%)
Gene names: PF1282, rub
FASTA Sequence
>pdb|1iu6|A
AKYVCKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEFEKLED