Toxin MIT1

Chain: A
Length: 80 amino acids
Theoretical weight: 8.53 KDa
Source organism: Dendroaspis polylepis polylepis
UniProt:
  • Canonical: P25687 (Residues: 1-80; Coverage: 99%)
FASTA Sequence
>pdb|1imt|A
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK
PDBe-KB: UniProt Coverage View: P25687