PDBe-KB: UniProt Coverage View:
P96618
![Holo-[acyl-carrier-protein] synthase in PDB entry 1f7t, assembly 2, front view.](https://www.ebi.ac.uk/pdbe/static/entry/1f7t_entity_1_front_image-200x200.png "Homo trimeric assembly 2 of PDB entry <span class='highlight'>1f7t</span> contains 3 copies of <span class='highlight'>Holo-[acyl-carrier-protein] synthase</span>. Front view.")
![Holo-[acyl-carrier-protein] synthase in PDB entry 1f7t, assembly 2, side view.](https://www.ebi.ac.uk/pdbe/static/entry/1f7t_entity_1_side_image-200x200.png "Homo trimeric assembly 2 of PDB entry <span class='highlight'>1f7t</span> contains 3 copies of <span class='highlight'>Holo-[acyl-carrier-protein] synthase</span>. Side view.")
![Holo-[acyl-carrier-protein] synthase in PDB entry 1f7t, assembly 2, top view.](https://www.ebi.ac.uk/pdbe/static/entry/1f7t_entity_1_top_image-200x200.png "Homo trimeric assembly 2 of PDB entry <span class='highlight'>1f7t</span> contains 3 copies of <span class='highlight'>Holo-[acyl-carrier-protein] synthase</span>. Top view.")
Chains: A, B, C, D, E, F
Length: 122 amino acids
Theoretical weight: 13.69 KDa
Source organism: Bacillus subtilis
Expression system: Escherichia coli
UniProt:
FASTA Sequence
Length: 122 amino acids
Theoretical weight: 13.69 KDa
Source organism: Bacillus subtilis
Expression system: Escherichia coli
UniProt:
- Canonical: P96618 (Residues: 2-121; Coverage: 99%)
FASTA Sequence
>pdb|1f7t|A B C D E F
GGIYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSPAAVHVSITHTKEYAAAQVVIERLSS
PDBe-KB: UniProt Coverage View:
P96618