PDBe-KB: UniProt Coverage View:
P96618
![Holo-[acyl-carrier-protein] synthase in PDB entry 1f7l, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/1f7l_entity_1_front_image-200x200.png "Homo trimeric assembly 1 of PDB entry <span class='highlight'>1f7l</span> contains 3 copies of <span class='highlight'>Holo-[acyl-carrier-protein] synthase</span>. Front view.")
![Holo-[acyl-carrier-protein] synthase in PDB entry 1f7l, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/1f7l_entity_1_side_image-200x200.png "Homo trimeric assembly 1 of PDB entry <span class='highlight'>1f7l</span> contains 3 copies of <span class='highlight'>Holo-[acyl-carrier-protein] synthase</span>. Side view.")
![Holo-[acyl-carrier-protein] synthase in PDB entry 1f7l, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/1f7l_entity_1_top_image-200x200.png "Homo trimeric assembly 1 of PDB entry <span class='highlight'>1f7l</span> contains 3 copies of <span class='highlight'>Holo-[acyl-carrier-protein] synthase</span>. Top view.")
Chain: A
Length: 121 amino acids
Theoretical weight: 13.63 KDa
Source organism: Bacillus subtilis
Expression system: Escherichia coli
UniProt:
FASTA Sequence
Length: 121 amino acids
Theoretical weight: 13.63 KDa
Source organism: Bacillus subtilis
Expression system: Escherichia coli
UniProt:
- Canonical: P96618 (Residues: 1-121; Coverage: 100%)
FASTA Sequence
>pdb|1f7l|A
GIYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKRKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSPAAVHVSITHTKEYAAAQVVIERLSS
PDBe-KB: UniProt Coverage View:
P96618