Coagulation factor IXa light chain

Chains: B, C
Length: 39 amino acids
Theoretical weight: 4.28 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: P00740 (Residues: 92-130; Coverage: 9%)
Gene name: F9
FASTA Sequence
>pdb|1edm|B C
VDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCEL
PDBe-KB: UniProt Coverage View: P00740