Major urinary protein 2

Chain: A
Length: 162 amino acids
Theoretical weight: 18.73 KDa
Source organism: Mus musculus
Expression system: Komagataella pastoris
UniProt:
  • Canonical: P11589 (Residues: 19-180; Coverage: 100%)
Gene name: Mup2
FASTA Sequence
>pdb|1df3|A
EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE