Cellular retinoic acid-binding protein 2

Chain: A
Length: 137 amino acids
Theoretical weight: 15.58 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: P29373 (Residues: 2-138; Coverage: 99%)
Gene name: CRABP2
FASTA Sequence
>pdb|1cbs|A
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE