Item _entity_poly.ndb_seq_one_letter_code

Description

              Chemical sequence expressed as string of one-letter 
               amino acid codes including modifications. 

A  for alanine or adenine
B  for ambiguous asparagine/aspartic-acid
R  for arginine
N  for asparagine
D  for aspartic-acid
C  for cysteine or cystine or cytosine
Q  for glutamine
E  for glutamic-acid
Z  for ambiguous glutamine/glutamic acid
G  for glycine or guanine
H  for histidine
I  for isoleucine
L  for leucine
K  for lysine
M  for methionine
F  for phenylalanine
P  for proline
S  for serine
T  for threonine or thymine
W  for tryptophan
Y  for tyrosine
V  for valine
U  for uracil
X  for modified or unknown 

Local Description

The sequence expressed as string of one-letter amino acid or nucleic acid codes.

Letters should not be separated by commas or spaces.

The one-letter code sequence derived from your coordinates is displayed 
by Pre-Deposition Data Format Check.   You may edit this as necessary and 
copy the result into this sequence data item.

Here is the list of one-letter codes:

A  for alanine or adenine
B  for ambiguous asparagine/aspartic-acid
R  for arginine
N  for asparagine
D  for aspartic-acid
C  for cysteine or cystine or cytosine
Q  for glutamine
E  for glutamic-acid
Z  for ambiguous glutamine/glutamic acid
G  for glycine or guanine
H  for histidine
I  for isoleucine
L  for leucine
K  for lysine
M  for methionine
F  for phenylalanine
P  for proline
S  for serine
T  for threonine or thymine
W  for tryptophan
Y  for tyrosine
V  for valine
U  for uracil

Category

Item Examples

Example 1:

MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD

Mandatory Code

Data Type Code