triangle PDBeMotif: 9ins  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification hormone    | release date: Wed, Oct 23, 1991
Title monovalent cation binding in cubic insulin crystals
Authors G.G.DODSON, J.BADGER
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GIVEQCCTSICSLYQLENYCN
Chain B sequence:
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN (CHAIN A)
member of: GENE3D:searchG3DSA_1.10.100.10PANTHER:searchPTHR11454/searchPTHR11454_SF19PFAM:searchPF00049PRINTS:searchINSULIN/searchINSULINFAMLYPROSITE PATTERNS:searchPS00262, SMART:searchSM00078SUPERFAMILY:searchSSF56994UniProt:searchP01315
sec str:  ..hhhhhhhhhh.hhhhhh....
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  INSULIN ..     ^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |      ****| 
search RasMol script viewer Motif-ligand binding stats  niche ..     ****       **** 

chain B : INSULIN (CHAIN B)
member of: GENE3D:searchG3DSA_1.10.100.10PANTHER:searchPTHR11454/searchPTHR11454_SF19PFAM:searchPF00049PRINTS:searchINSULIN/searchINSULINFAMLYSMART:searchSM00078SUPERFAMILY:searchSSF56994UniProt:searchP01315
sec str:  ..........hhhhhhhhhhhh..........
sequence :  ..FVNQHLCGSHLVEALYLVCGERGFFYTPKA
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |  |    ^** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  ****        

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INSULIN (CHAIN A)
member of: GENE3D:searchG3DSA_1.10.100.10PANTHER:searchPTHR11454/searchPTHR11454_SF19PFAM:searchPF00049PRINTS:searchINSULIN/searchINSULINFAMLYPROSITE PATTERNS:searchPS00262, SMART:searchSM00078SUPERFAMILY:searchSSF56994UniProt:searchP01315
sec str:  ..hhhhhhhhhh.hhhhhh....
sequence :  ..GIVEQCCTSICSLYQLENYCN
seq num:  ..1         11         
search RasMol script viewer Motif-ligand binding stats  INSULIN ..     ^^***^********^ 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |      ****| 
search RasMol script viewer Motif-ligand binding stats  niche ..     ****       **** 

chain B : INSULIN (CHAIN B)
member of: GENE3D:searchG3DSA_1.10.100.10PANTHER:searchPTHR11454/searchPTHR11454_SF19PFAM:searchPF00049PRINTS:searchINSULIN/searchINSULINFAMLYSMART:searchSM00078SUPERFAMILY:searchSSF56994UniProt:searchP01315
sec str:  ..........hhhhhhhhhhhh..........
sequence :  ..FVNQHLCGSHLVEALYLVCGERGFFYTPKA
seq num:  ..1         11        21        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |  |    ^** 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  ****        

   New search    9ins:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors