triangle PDBeMotif: 7odc  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   4.1.1.17
Classification lyase    | release date: Wed, Mar 3, 1999
Title crystal structure ornithine decarboxylase from mouse, trunca residues from the c-terminus, to 1.6 angstrom resolution
Authors A.D.KERN, M.A.OLIVEIRA, M.L.HACKERT, P.COFFINO
Method X-RAY DIFFRACTION (resolution: 1.60Å)
PDBe Citation   
Small molecules:    search PLP PLP binding statistics PLP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MSSFTKDEFDCHILDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTL
AAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDS
KAVCRLSVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPDTFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPG
SEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKEQPGSDDEDESNEQTFMYYVND
GVYGSFNCILYDHAHVKALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGF
QRPNIYYVMSRPMWQLMKQIQSHG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (ORNITHINE DECARBOXYLASE)
member of: CATH:search2.40.37.10/search3.20.20.10GENE3D:searchG3DSA_2.40.37.10/searchG3DSA_3.20.20.10PANTHER:searchPTHR11482/searchPTHR11482_SF42PFAM:searchPF00278/searchPF02784PRINTS:searchODADCRBXLASE/searchORNDCRBXLASEPROSITE PATTERNS:searchPS00878/searchPS00879, SUPERFAMILY:searchSSF50621/searchSSF51419UniProt:searchP00860
JMol viewer RasMol script viewer  PLP 425A  ..                            ..                               * *                                                                                    *   ..                            *                                      **                                    * **                    ..PLP ..                                                 *                            *                             
sec str:  ...eeee..eeeeee.....hhhhhhhhh.......eeeee.hhhhhhhhhhhhh...eeeeee......hhhhhhhhh...eeee..hhhhhhhhh.......eee......hhhhhhhhh....eeee..hhhhhhhhhh....eeeee..........hhhhhhhhhhhhh...eeeeee..........hhhhhhhhhhhhhhhhhhhh.....eee..............hhhhhhhhhhhhhhh.......eeee...hhhh...eeeeeeeeeeeee.... ....eeeeee........hhhhh..................eeeeeee.............eeee......eeee.......hhh..........eeeeeee.hhhhhh.
sequence :  ..SSFTKDEFDCHILDEGFTAKDILDQKIN..DKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIAT..KFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPDTFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPGSEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVW... ..EQTFMYYVNDGVYGSFNCILYDHAHVKALLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRPMWQLMK
seq num:  ..2         12        22      ..36        46        56        66        76        86        96        106       116       126       136       146         ..169       179       189       199       209       219       229       239       249       259       269       279       289      ... ..311       321       331       341       351       361       371       381       391       401       411     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |       | || ||       ..        | |||          |  |   |  | ^***        |||  |  |  |    | ||| |  |                 | | |    |  ||      |  |        ..|   | ||||     || |||       | |  ||| |               |  | |     | ||  | | ||                      | ||   |   |  |  |             ..PS00001..          |    ||  ||| |     | || |  |  |     | | | |  ||        |  |     ||||| |  |||| |          |   |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |       | |^**|       ..        | |||          |  |   |  | | |         |||  |  |  |    | ||| |  |                 | | |    |  ||      |  |        ..*   ^**^**     || |||       | |  ||| |               |  | |     | ||  | | ||                      | ||   |   |  |  |             ..PS00005..          |    ||  ||| |     | || |  |  |     | | | |  ||        |  |     ||||| |  |||| |          |   |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***       | |^***       ..        | |||          |  |   |  | | |         ||^***  ^***    | ||| |  |                 | | |    ^***|      |  |        ..    |   |      || |||       | |  |^***               |  | |     | ||  | | ||                      | ||   |   |  |  |             ..PS00006..          |    ||  ||| |     | || |  |  |     | | | |  ||        |  |     ||||| |  |||| |          |   |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..              | |           ..        | |||          |  |   |  | | |         |||             | ||| |  |                 | | |    |   |      |  |        ..    |   |      || |||       | |  | |                 |  | |     | ||  | | ||                      | |********^  |  |             ..PS00007..          |    ||  ||| |     | |********^     | | | |  ||        |  |     ||||| |  |||| |          |   |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              | |           ..        | |||          |  |   |  | | |         |||             | ||| |  |                 | | |    |   |      |  |        ..    |   |      || |||       | ^*****                 |  | |     | |^***** ||                      | |    |      |  |             ..PS00008..          ^*****|  ||| |     | |  |  |        | | | |  ||        |  |     ||||| |  |||| |          |   |    
search RasMol script viewer Motif-ligand binding stats  ODR_DC_2_1 ..              | |           ..        | |||          |  |   ***^***************|             | ||| |  |                 | | |    |   |      |  |        ..    |   |      || |||       | |  |                   |  | |     | |   | | ||                      | |    |      |  |             ..PS00878..                |  ||| |     | |  |  |        | | | |  ||        |  |     ||||| |  |||| |          |   |    
search RasMol script viewer Motif-ligand binding stats  ODR_DC_2_2 ..              | |           ..        | |||          |  |        | |         | |             | ||| |  |                 | | |    |   |      |  |        ..    |   |      || |||       | |  |                   ****************** | ||                      | |    |      |  |             ..PS00879..                |  ||| |     | |  |  |        | | | |  ||        |  |     ||||| |  |||| |          |   |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              | |           ..        | |||          |  |        | |         | |             | ||| |  |                 | | |    |   |      |  |        ..    |   |      || |||       | |  |                      | |     | |     | ||                      | |    |      |  |             ..alphabetamotif..                *****| |     | |  |  |        | | | |  ||        |  |     ||||| |  |||| |          |   |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..              | |           ..        *****          |  |        | |         | |             | ||| |  |                 | | |    |   |      |  |        ..    |   |      || |||       | |  |                      | |     | |     | ||                      | |    |      |  |             ..asxmotif..                |  | | |     | |  |  |        | | | |  ||        |  |     ||||| |  |||| |          |   |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..              | |           ..        ***|           |  |        ***         | |             | ||| |  |                 | | |    |   |      |  |        ..    |   |      || |||       | |  |                      | |     ***     | ||                      | |    |      |  |             ..asxturn..                |  | | |     | |  |  |        | | ***  ||        |  |     ||||| |  |||| |          |   |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | |           ..        |  |           |  |        | |         | |             | ||| |  |                 | | |    |   |      |  |        ..    |   |      || |||       | |  |                      | |             | ||                      | |    |      |  |             ..betabulge..                |  | | |     | |  |  |        | |      **        |  |     ||||| |  |||| |          |   |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |           ..        ****           |  |        | |         | |             ****| |  |                 | | |    |   |      |  |        ..    |   |      |****|       | |  |                      | |             | ||                      | |    |      |  |             ..betaturn..                **** | |     | |  |  |        | |                |  |     ||||| |  ||****          |   |    
search RasMol script viewer Motif-ligand binding stats  nest ..              | |           ..                       |  |        | |         ***               *** |  |                 *** |    |   |      |  |        ..    |   |      |  ***       | |  |                      ***             | ||                      ***    |      |  |             ..nest..                     ***     | |  |  |        | |                |  |     ***|***  || |            |   |    
search RasMol script viewer Motif-ligand binding stats  niche ..              ***           ..                       ****        ***                               ****                   ***    |   |      ****        ..    |   |      |    |       | ****                                      ****                      | |    |      ****             ..niche..                             ***  ****        ***                ****      ***  *******            |   |    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                            ..                                                                                                   |   |                  ..    |   |      ******       |                                           | |                       | |    |                       ..schellmannloop..                                                                                                   |   |    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                            ..                                                                                                   *****                  ..    *****                   |                                           | |                       | |    |                       ..stmotif..                                                                                                   *****    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                            ..                                                                                                                          ..    *****                   |                                           | |                       | |    |                       ..ststaple..                                                                                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                            ..                                                                                                                          ..                            |                                           ***                       ***    |                       ..stturn..                                                                                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                            ..                                                                                                                          ..                            *                                                                            *                       ..REP00000..                                                                                                            

   New search    7odc:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors