triangle PDBeMotif: 4xxl  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification electron transport    | release date: Fri, Jan 30, 2015
Title crystal structure of class 1 cytochrome mtod from sideroxyda lithotrophicus es-1
Authors C.R.BECKWITH, M.J.EDWARDS, T.CLARKE
Method X-RAY DIFFRACTION (resolution: 1.47Å)
PDBe Citation   
Small molecules:    search HEM HEM binding statistics HEM
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MTRQAYSSMLLSTAAALTLAFSLNASAAVDVDAAKSLARENNCFKCHGVDKEKDGPSYKKVAEKYRGKADAEAKLIHHVT
SGEKAKFPDGHEEEHKNINGKASPEAIKNLVDWILSLWSHPQFEK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOCHROME C CLASS I
member of: GENE3D:searchG3DSA_1.10.760.10PFAM:searchPF00034PRINTS:searchCYTCHROMECIDPROSITE PROFILES:searchPS51007, SUPERFAMILY:searchSSF46626UniProt:searchD5CN26
JMol viewer RasMol script viewer  HEM 201A  ..              **  **      *** *  *  **            **     **        ** *                     
sec str:  ....hhhhhhhhhhhhhhhhhh.........hhhhhhhhhh...hhhhhhhhhhhhh.eee.....eee........hhhhhhhhhhhhhh...
sequence :  ..AVDVDAAKSLARENNCFKCHGVDKEKDGPSYKKVAEKYRGKADAEAKLIHHVTSGEKAKFPDGHEEEHKNINGKASPEAIKNLVDWILSLWS
seq num:  ..28        38        48        58        68        78        88        98        108         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             ||||| ||  | | | ||| | | || |       ||  || |   | |||     | || |                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             ||||| ||  | | | ^** | | || |       ||  || |   | |||     | || |                 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             ||||| ||  | | | ||  | | || |       ||  ^***   | |||     | || |                 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..             ||||| ||  *******^  | | || |       ||  || |   | |||     | || |                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..             ||||| ||  | | | |   | | || |       ||  || |   | |||     ***| |                 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..             ||||| ||  | | | |   | | || |       ||  || |   *****     | || |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |**** ||  | | | |   | | || |       ||  || |   ****|     | || |                 
search RasMol script viewer Motif-ligand binding stats  nest ..             ****  ||  | | | |   | | || |       ||  |***     ***     | |***                 
search RasMol script viewer Motif-ligand binding stats  niche ..                ******** *** |   | ******       ||  ||               ***                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                             *****              ||  ||                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                ******                                      

   New search    4xxl:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors