triangle PDBeMotif: 4x8p  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Wed, Dec 10, 2014
Title crystal structure of ash2l spry domain in complex with rbbp5
Authors A.SHILATIFARD, C.P.CHATURVEDI, G.SKINIOTIS, J.-F.COUTURE, J.S.BRUNZELLE, M.BRAND, P.ZHANG
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SRVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSY
SWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDISGRGSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSI
NFGPCFKYPPKDLTYRPMSDMG
Chain B sequence:
EYEERESEFDIE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SET1/ASH2 HISTONE METHYLTRANSFERASE COMPLEX SUBUNSET1/ASH2 HISTONE METHYLTRANSFERASE COMPLEX SUBUNIT ASH2;
member of: PANTHER:searchPTHR10598PFAM:searchPF00622PROSITE PROFILES:searchPS50188, SMART:searchSM00449SUPERFAMILY:searchSSF49899UniProt:searchQ9UBL3
JMol viewer RasMol script viewer  GOL 401B  ..                                                                                                                   ..                                                             
sec str:  ......eeeeee....ee.....eee.....eeeee......eeeeeeeeeee.....eeeeeee...............eeeee.....eee..eee..........eeeeeeee.....eeeeee..eeeeeeee.......eeeeeee...eeeee..............ee.hhhh
sequence :  ..SRVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLP..GSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMG
seq num:  ..285       295       305       315       325       335       345       355       365       375       385       395  ..444       454       464       474       484       494        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..          |  |  | ||||              |    |     | || |  |       |  || |   | |  | | ||**^*              |  |         ..      || ||| |||||      |                | |    |  || || || |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |  |  | ||||              |    |     | || |  |       |  || |   | |  | ^**^**                |  |         ..      || ||| |||||      |                | |    |  |^**| || |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |  | ||||              |    |     ^*** |  |       |  || |   | |  |                       |  |         ..      || ||| |||||      |                | |    |  |   | || |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          |  |  | ||||              |    |       || |  |       |  || |   | |  |                       |  |         ..******^| ||| ||||*******^                | |    |  |   | || |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  |  | ||||              ^*****       || |  |       |  || |   | |  |                       |  |         ..       | ^*****||                        | |    |  |   | || |
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |  | ||||                           || |  |       |  |***   | |  |                       |  |         ..       |  |*** ||                        | |    |  |   | || |
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  |  | ||||                           ** |  |       |  |      | |  |                       |  |         ..       |  |    **                        | |    |  |   | || |
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |  ****||                              |  |       |  |      | |  |                       ****         ..       ****                              | |    |  |   ******
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |    ****                              |  |       |  |      ***  |                       |  |         ..                                         | |    |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..          ****                                      ****       ****        ****                       ****         ..                                         ***    ****         

chain B : RETINOBLASTOMA-BINDING PROTEIN 5
member of: PANTHER:searchPTHR12816UniProt:searchQ15291
JMol viewer RasMol script viewer  GOL 401B  ..       **   
sec str:  ..............
sequence :  ..EYEERESEFDIE
seq num:  ..344         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      ^***  
search RasMol script viewer Motif-ligand binding stats  niche ..      ****  

   New search    4x8p:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors