triangle PDBeMotif: 4utx  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.5.1.
Classification hydrolase    | release date: Wed, Jul 23, 2014
Title crystal structure of zebrafish sirtuin 5 in complex with 3- nitro-propionylated cps1-peptide
Authors C.STEEGBORN, M.GERTZ, M.PANNEK
Method X-RAY DIFFRACTION (resolution: 3.10Å)
PDBe Citation   
Small molecules:    search BEZ BEZ binding statistics BEZ   search ZN ZN binding statistics ZN   search DMS DMS binding statistics DMS   search 3NP 3NP binding statistics 3NP   search NA NA binding statistics NA   search EPE EPE binding statistics EPE   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GIDPFTTRPSSDLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFWRKWQAQDLATPEAFSRDPSLVWEFYHYRRE
VMRSKMPNPAHLAIAECEARLGQQGRSVVIITQNIDELHHRAGSKHVYEIHGSLFKTRCMSCGEVKANHKSPICPALDGK
GAPDPNTKEARIPVELLPRCERKSCNGLLRPHVVWFGETLDSDILTAVERELEKCDLCLVVGTSSIVYPAAMFAPQVASR
GVPVAEFNMECTPATQRFKYHFEGPCGSTLPPALE
Chain C sequence:
GVLKEYGV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NAD-DEPENDENT PROTEIN DEACYLASE SIRTUIN-5, MITOCH
member of: GENE3D:searchG3DSA_3.30.1600.10/searchG3DSA_3.40.50.1220HAMAP:searchMF_01121PANTHER:searchPTHR11085/searchPTHR11085_SF13PFAM:searchPF02146PROSITE PROFILES:searchPS50305, SUPERFAMILY:searchSSF52467UniProt:searchQ6DHI5
JMol viewer RasMol script viewer  3NP 1004C  ..                                *              *               *  *                                                                                                                  ** *                                                            ..3NP ..                 
JMol viewer RasMol script viewer  EDO 1301A  ..                                |              |               |  |                                                                                                                  || |                         *                         ***      ..EDO ..                 
JMol viewer RasMol script viewer  EDO 1300A  ..                                |              |               |  |                                  **                *                                                             || |                         |                         |||      ..EDO ..                 
JMol viewer RasMol script viewer  ZN 1299A  ..                                |              |               |  |                                  ||                |       *  *                                     *    *       || |                         |                         |||      ..ZN ..                 
JMol viewer RasMol script viewer  BEZ 0C  ..                                |              |               |  |                                  ||                |       |  |                                     |    |       || |                         |                         |||      ..BEZ ..                 
sec str:  ..hhhhhhhhhhhh.eeeeeehhhhhhh................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..eeeeee....hhhhhh....eee..eeeeeeee.....eee......hhhhh..............hhhhh...........eeeee.......hhhhhhhhhhhhhhh.eeeee.......hhhhhhhhhhh....eeeee........... ...eeee.hhhhhhhhhhh
sequence :  ..DLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFWRKWQAQDLATPEAFSRDPSLVWEFYHYRREVMRSKMPNPAHLAIAECEARLGQQGRSVVIITQNIDELHHRAGSKHVYEIHGSLFKTRCMSCGEVKANHKSPICPALDGKGAPDPNTKEARIPVELLPRCERKSCNGLLRPHVVWFGETLDSDILTAVERELEKCDLCLVVGTSSIVYPAAMFAPQVASRGVPVAEFNMECTPATQ... ..KYHFEGPCGSTLPPALE
seq num:  ..35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275  ... ..282       292    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       || ||       |   || ||| ^**|  |      |  ||                    | || |  | |           | |||     | | ||||| |||        | ||    || |   | |    | || | | |  |  | ||| ||    | || |       |  |   |   |  |  |  |        | ||       | ||||||   | | |   |^*..PS00005..      |  ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       || ||       |   || ||| | ||  |      |  ||                    | || |  | |           | |||     | | ||||| |||        | ||    ^***   | |    | || | | |  |  | ||| ||    | || |       |  |   |   ^***  |  |        | ||       | ||||||   | | |   | |..PS00006..      |  ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       || ||       ^***** ||| | ||  |      |  ||                    | || |  | |           | |||     | | ||||| |||        | ||     | |   | |    | || | | |  |  | ||| ||    | || |       |  |   |   |     |  |        | ||       | ||||^***** | |   | |..PS00008..      |  ||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       *****           || ||| | ||  |      *****                    | || |  | |           | |||     | | ||||| |||        | ||     | |   | |    | || | | |  |  | |*****    | || |       |  |   |   |     |  |        | ||       | ||||||     | |   | |..alphabetamotif..      *****      
search RasMol script viewer Motif-ligand binding stats  asxturn ..       || ||           || ||| | ||  |      |  |                     | || |  ***           | |||     | | ***|| |||        | ||     | |   | |    | || | | |  |  | ||| ||    | || |       |  |   |   |     |  |        | ||       | ||||||     | |   | |..asxturn..      |  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|           |****| | |****      ****                     ******                ****|     | | ||||****|        | ||     | |   | |    ****** | ****  | |****|    | || |       |  |   |   |     |  |        | ||       | |****|     | |   | |..betaturn..      ****       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        |  |           |  | | | |                                     |  |                  | |     | | ||||  | |        | ||     | |   | |    |  |   | |  |  | | |  |    ***| |       |  |   |   |     |  |        | ||       | | || |     | |   ***..gammaturn..                 
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |           |  *** ***                                     |  |                  ***     | | ****  ***        | ||     ***   | |    |  |   | |  |  *** |  |       ***       |  |   |   |     |  |        | ||       | | |***     | |      ..nest..                 
search RasMol script viewer Motif-ligand binding stats  niche ..        ****           |    |                                         ****                          ***    |    |        ****           ***    ****   ******      ****                 ****   |   |     ****        ****       | | |  |     ***      ..niche..                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                       ******                                                                       | |    ******        | |                                                                  |   |                 | |        | ******              ..schellmannloop..                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                    | |                  | |                                                                  *****                 | |        *****                 ..ststaple..                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    ***                  ***                                                                                        ***                              ..stturn..                 

chain C : CARBAMOYLPHOSPHATE SYNTHETASE I
member of: GENE3D:searchG3DSA_3.40.50.20PANTHER:searchPTHR11405PFAM:searchPF00289SUPERFAMILY:searchSSF52440TIGRFAMS:searchTIGR01369UniProt:searchQ5R209
JMol viewer RasMol script viewer  3NP 1004C  ..   *    
JMol viewer RasMol script viewer  EDO 1300A  ..   |    
JMol viewer RasMol script viewer  BEZ 0C  ..*  |    
sec str:  .....hhhhh
sequence :  ..GVLKEYGV
seq num:  ..1       

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : NAD-DEPENDENT PROTEIN DEACYLASE SIRTUIN-5, MITOCH
member of: GENE3D:searchG3DSA_3.30.1600.10/searchG3DSA_3.40.50.1220HAMAP:searchMF_01121PANTHER:searchPTHR11085/searchPTHR11085_SF13PFAM:searchPF02146PROSITE PROFILES:searchPS50305, SUPERFAMILY:searchSSF52467UniProt:searchQ6DHI5
JMol viewer RasMol script viewer  NA 1303B  ..                                                                                                                                                                                                                                                  ..NA ..                  
JMol viewer RasMol script viewer  EDO 1302B  ..                                                                                                        **                                                                                                                                        ..EDO ..                  
JMol viewer RasMol script viewer  DMS 1301B  ..                                                                                                        ||     ***                                                                                                                                ..DMS ..                  
JMol viewer RasMol script viewer  ZN 1299B  ..                                                                                                        ||     |||               *  *                                     *    *                                                                  ..ZN ..                  
sec str:  ....hhhhhhhhhhhh.eeeeeehhhhhhh................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..eeeeee....hhhhhh....eee..eeeeeeee.....eee......hhhhh..............hhhhh...........eeeee.......hhhhhhhhhhhhhhh.eeeee.......hhhhhhhhhhh....eeeee...... ....eeee.hhhhhhhhhhh
sequence :  ..SSDLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFWRKWQAQDLATPEAFSRDPSLVWEFYHYRREVMRSKMPNPAHLAIAECEARLGQQGRSVVIITQNIDELHHRAGSKHVYEIHGSLFKTRCMSCGEVKANHKSPICPALDGKGAPDPNTKEARIPVELLPRCERKSCNGLLRPHVVWFGETLDSDILTAVERELEKCDLCLVVGTSSIVYPAAMFAPQVASRGVPVAEFNMEC... ..FKYHFEGPCGSTLPPALE
seq num:  ..33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263         ... ..281       291     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| |      || ||       |   || ||| ^**|  |      |  ||                    | || |  | |           | |||     | | ||||| |||        | ||    || |   | |    | || | | |  |  | ||| ||  | |  | |       |  |   |   |  |  |  |        |  |       | ||||||   |     ..PS00005..       |  ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |      || ||       |   || ||| ||||  |      |  ||                    | || |  | |           | |||     | | ||||| |||        | ||    ^***   | |    | || | | |  |  | ||| ||  | |  | |       |  |   |   ^***  |  |        |  |       | ||||||   |     ..PS00006..       |  ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |      || ||       ^***** ||| ||||  |      |  ||                    | || |  | |           | |||     | | ||||| |||        | ||     | |   | |    | || | | |  |  | ||| ||  | |  | |       |  |   |   |     |  |        |  |       | ||||^*****     ..PS00008..       |  ||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |      *****           || ||| ||||  |      *****                    | || |  | |           | |||     | | ||||| |||        | ||     | |   | |    | || | | |  |  | |*****  | |  | |       |  |   |   |     |  |        |  |       | ||||||         ..alphabetamotif..       *****      
search RasMol script viewer Motif-ligand binding stats  asxturn ..| |      || ||           || ||| ||||  |      |  |                     | || |  ***           | |||     | | ***|| |||        | ||     | |   | |    | || | | |  |  | ||| ||  | |  | |       |  |   |   |     |  |        |  |       | ||||||         ..asxturn..       |  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |      ****|           |****| |||****      ****                     ******                ****|     | | ||||****|        | ||     | |   | |    ****** | ****  | |****|  | **** |       |  |   |   |     |  |        |  |       | |****|         ..betaturn..       ****       
search RasMol script viewer Motif-ligand binding stats  nest ..| |       |  |           |  *** ****                                    |  |                  ***     | | ****  ***        | ||     ***   | |    |  |   | |  |  *** |  |  | |  ***       |  |   |   |     |  |        |  |       | | |***         ..nest..                  
search RasMol script viewer Motif-ligand binding stats  niche ..| |       ****           |    |                                         ****                          ***    |    |        ****           ***    ****   ******      ****  ***            ****   |   |     ****        ****       | | |  |         ..niche..                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..| |                      ******                                                                       | |    ******        | |                                                                  |   |                            | ******         ..schellmannloop..                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..| |                                                                                                   | |                  | |                                                                  *****                            *****            ..ststaple..                  
search RasMol script viewer Motif-ligand binding stats  stturn ..***                                                                                                   ***                  ***                                                                                                                    ..stturn..                  

   New search    4utx:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors