triangle PDBeMotif: 4uft  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification rna binding protein    | release date: Thu, Mar 19, 2015
Title structure of the helical measles virus nucleocapsid
Authors A.DESFOSSES, C.SACHSE, G.EFFANTIN, G.SCHOEHN, I.GUTSCHE, M.HAUPT, R.W.H.RUIG, W.L.LING
Method ELECTRON MICROSCOPY (resolution: 4.30Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain B sequence:
MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLF
VESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFASRGTNMEDEADQYFSHDDPISSDQSRFGWFENKEISDIEVQDP
EGFNMILGTILAQIWVLVAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALILDI
KRTPGNKPRIAEMICNIDTYIVEAGLASFILTIKFGIETMYPALGLHEFDGELSTLESLMNLYQQMGETAPYMVILENSI
QNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : NUCLEOPROTEIN
member of: PFAM:searchPF00973UniProt:searchP10050
sec str:  ...hhhhhhhhhhhhhh....................eeeee......hhhhhhhhhhhhhh....hhhhhhhhhhhhhh....hhhhhhhhhh.......eeeee...............................................hhhhhhhhhhhhhhhhhhh...........hhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh......hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh.........hhhhh.......hhhhhhhhhhhh.................hhhhhhhhhhhhhhhh..................
sequence :  ..MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLFVESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFA..EDEADQYFSH..SRFGWFENKEISDIEVQDPEGFNMILGTILAQIWVLVAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALILDIKRTPGNKPRIAEMICNIDTYIVEAGLASFILTIKFGIETMYPALGLHEFDGELSTLESLMNLYQQMGETAPYMVILENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111    ..124       ..142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |                | |    |                 ^**                 |   ||  | | |             | |  |^**        ||||| | |..|       | ..     | |   |  |  | || ||  ||   |         |  |||||    |  | | | | | |                   ^**        ||  |           |   | ||| |      ^**|   | |            |  |         | |    |  |     | |                   | | ||   ||  |  |          | | | | |      |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |                | |    |                                     |   ||  | | |             | |  |           ||||| | |..*       ^*..     | |   ^***  | || ||  ||   |         ^***^***    |  | | | | | |                              ||  |           |   | ||| |        ||   | |            ^***         | |    |  |     | |                   | | ||   |^***  |          | | | | |      ^*** 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |                | |    |                                     |   ||  | | |             | |  |           ||||| | |..          ..     | |         | || ||  ||   |            | ||     |  | | | | | |                              ||  |           |   | ||| |        *******^                         | |    |  |     | |                   | | ||   *******^          | | | | |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |                | ^*****                                     |   |^***** |             | |  |           ||||^****..          ..     | |         | || ||  ^*****            | ||     |  | | | | | |                              ||  |           |   | ||| |         |   | |                         | |    |  |     | |                   | | ^*****                 | | | | |           
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |                ***                                          |   |   |   |             | |  |           ||||  | |..          ..     | |         | || ||   |                | ||     |  | | *** ***                              ||  |           |   | *****         |   | |                         ***    |  |     | |                   ***  |                     | *** ***           
search RasMol script viewer Motif-ligand binding stats  nest .. ***                                                             |   |   |   |             ***  |           ****  ***..          ..     | |         | |***|   |                ***|     |  | | |                                    ||  |           |   |  |            |   ***                                |  |     | |                     |  |                     ***                 
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                 |   |   |   |               ****                    ..          ..     ***         ***   |   |                ****     **** ***                                    |****           |   ****            |   |                                  ****     ***                     ****                     ***                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                 *****   *****                                       ..          ..                       *****                                                                     *****           *****               *****                                                                                                                

chain R : 5'-R(*CP*CP*CP*CP*CP*CP)-3'
sec str:  ........
sequence :  ..CCCCCC
seq num:  ..7     

   New search    4uft:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML