triangle PDBeMotif: 4tr8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.7.7
Classification dna binding protein    | release date: Sun, Jun 15, 2014
Title crystal structure of dna polymerase sliding clamp from pseud aeruginosa
Authors D.BURNOUF, E.ENNIFAR, P.WOLFF, V.OLIERIC
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search NA NA binding statistics NA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
HHHHHHSSGLVPRGSHMHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVVLEDAAE
PGEITVPARKLMDICKSLPNDVLIDIRVEEQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSF
AMAQQDVRYYLNGMLLEVNGGTLRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQHHI
RATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSNEKYRGIRLQLSNGLLKIQANNPEQEEAE
EEVQVEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFILSDSNSSALVHEADNDDSAYVVMPMRL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA POLYMERASE III SUBUNIT BETA
JMol viewer RasMol script viewer  NA 1001A  ..                                      ..                                                                                                                                                                                                                                          *                                                                                                          
sec str:  ........................hhhhhhhhhhhhhh.....hhhh.eeeeeee..eeeeeee...eeeeeeee.......eeeeeehhhhhhhhhhh....eeeeeee..eeeeee..eeeeee..hhhhh.......eeeeeeeehhhhhhhhhhhhhhh.....hhhh.eeeeeee..eeeeeee...eeeeeeee........eeeeeehhhhhhhhhhh.....eeeeeee..eeeee...eeeeee.......hhhhhh.....eeeeeehhhhhhhhhhhhh.......eeeeeee..eeeeeee.....eeeeeee.......eeeeeehhhhhhhhhhh...eeeeee......eeeee.....eeeee....
sequence :  ..HHHHHHSSGLVPRGSHMHFTIQREALLKPLQLVAGVVE..TLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVVLEDAAEPGEITVPARKLMDICKSLPNDVLIDIRVEEQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLLEVNGGTLRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSNEKYRGIRLQLSNGLLKIQANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFILSDSNSSALVHEADNDDSAYVVMPMR
seq num:  ..9985      9995      5         15      ..26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              | |                |  | ..|  |  |      |    || |||||       | |                 |  ||  |               | |        |  | |  |   ||^***       |   ||  ||  | |  |        ||| | | |||||       | | | |                 ||| ||  |   || |   |  |   | |        || ||    ||    |   |  |   ||  || || |     |  |        | |                   ^***   ||||| |||      | ^***   |  | ||        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..              | |                |  | ..*  |  |      |    || |||||       | |                 |  ||  |               | |        |  | |  |   ||           |   ||  ||  | |  |        ||| | | |||||       | | | |                 ||| ||  |   || |   |  |   | |        || ||    ||    |   |  |   ||  || || |     |  |        | |                   | |    ||||| |||      | ||     |  | ||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              | |                |  | ..   |  |      |    || |||||       | |                 |  ||  |               | |        |  | |  |   ||           |   ||  ||  | |  |        ||^** | |||||       | | | |                 ||| ||  |   || |   |  |   ^**        || ||    ||    |   |  |   ||  || || |     |  |        | |                   | |    ||||| |||      | ||     |  | ||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              | |                |  | ..   |  |      |    |^***|||       | |                 |  ||  |               | |        |  | ^***   ||           |   ||  ||  | |  |        |||   | |||||       | | | |                 |^***|  |   || |   ^***              || ||    ||    |   |  |   ||  || || |     |  |        | |                   | |    ||||| |||      | ||     |  | ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              | |                |  | ..   |  |      ^*****  |||||       | |                 |  ||  |               | |        |  |        ||           |   ||  ||  | |  |        |^***** |||||       | | | |                 | |  |  ^***** |                     || ||    ||    |   |  |   ||  || || |     |  |        | |                   | |    ||^*****|      | ||     |  | ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              | |                |  | ..   |  |              |||||       | |                 |  ||  |               | |        |  |        ||           |   ||  ||  | |  |        | |     |||||       | | | |                 | |  |      |  |                     || ||    ||    |   |  |   ||  || || |     |  |        | |                   | |    ***** | |      | ||     |  | ||        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..              | |                |  | ..   |  |              |||||       | |                 |  ||  |               | |        |  |        ||           |   ||  ||  | |  |        | |     |||||       | | | |                 | |  |      |  |                     || ||    ||    *****  |   ||  || || |     |  |        | |                   | |    || || | |      | ||     |  | ||        
search RasMol script viewer Motif-ligand binding stats  asxturn ..              | |                |  | ..   |  |              |||||       | |                 |  ||  |               | |        |  |        ||           |   ||  ||  ***  |        | |     |***|       | | | |                 | |  |      |  |                     || ||    ||           |   ||  |***| |     |  |        | |                   ***    || || | |      ***|     |  ***|        
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | |                |  | ..   |  |              |||||       | |                 |  ||  |               | |        |  |        **           |   ||  ||  | |  |        | |     |||||       | | | |                 | |  |      |  |                     || ||    **           |   ||  |   | |     |  |        | |                          || || | |      |  |     |  |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |                |  | ..   |  |              |||||       | |                 |  |****               | |        ****                     |   ||  ||  | ****        | |     |||||       | | | |                 | ****      |  |                     ****|                 |   |****   | |     |  |        | |                          ****| | |      |  |     |  |  |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              | |                |  | ..   |  |              |||||       | |                 |  ||  |               | |        |  |                     |   ||  ||  |             | |     |||||       | *** |                 | |  |      |  |                      |  |                 |   ||  |   | |     |  |        | |                           |  | | |      |  |     |  |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..              | |                |  | ..   |  |              |****       | |                 |  ||  |               | |        |  |                     |   ||  ||  |             | |     |****       *** | |                 | |  |      |  |                      |  |                 |   ||  |   ***     |  |        ***                           |  | | |      |  |     |  |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..              ***                **** ..   ****              | |         ***                 ********               ***        ****                     |   |********             ***     | |             ***                 ******      ****                      ****                 |   |****           ****                                      ********      ****     *******        
search RasMol script viewer Motif-ligand binding stats  ststaple ..              | |                     ..                     | |                                                                                        *****                             | |                                                                                            *****                                                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..              ***                     ..                     ***                                                                                                                          ***                                                                                                                                                                                                

chain B : DNA POLYMERASE III SUBUNIT BETA
sec str:  ....eeeeehhhhhhhhhhhhh......hhhh.eeeeeee..eeeeeee...eeeeeeee.......eeeeeehhhhhhhhhhh....eeeeeee..eeeeee..eeeeee..hhhhh.......eeeeeehhhhhhhhhhhhhhh.....hhhh.eeeeeee..eeeeeee...eeeeeeee........eeeeeehhhhhhhhhhh.....eeeeee...eeeee...eeeeee.......hhhhh......eeeeeehhhhhhhhhhhhh.......eeeeeee..eeeeeee.....eeeeeee.......eeeeeehhhhhhhhhhh...eeeeee......eeeee.....eeeee.....
sequence :  ..HMHFTIQREALLKPLQLVAGVVE..TLPVLSNVLLVVEGQQLSLTGTDLEVELVGRVVLEDAAEPGEITVPARKLMDICKSLPNDVLIDIRVEEQKLLVKAGRSRFTLSTLPANDFP..GPGSLNFSIAQSKLRRLIDRTSFAMAQQDVRYYLNGMLLEVNGGTLRSVATDGHRLAMCSLDAQIPSQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQHHIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILSNEKYRGIRLQLSNGLLKIQANNPEQEEAEEEVQVEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFILSDSNSSALVHEADNDDSAYVVMPMRL
seq num:  ..0         10        20 ..26        36        46        56        66        76        86        96        106         ..122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |  | ..|  |  |      |    || |||||       | |                 |  ||  |               | |        |  | ..   ||^***       |   ||  ||  | |           ||| | | |||||       | | | |                 ||| ||  |   || |   |  |   | |        || ||    ||           |   ||  || || |     |  |        | |                   ^***    || | |||      | ^***   |  | ||         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                  |  | ..*  |  |      |    || |||||       | |                 |  ||  |               | |        |  | ..   ||           |   ||  ||  | |           ||| | | |||||       | | | |                 ||| ||  |   || |   |  |   | |        || ||    ||           |   ||  || || |     |  |        | |                   | |     || | |||      | ||     |  | ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |  | ..   |  |      |    || |||||       | |                 |  ||  |               | |        |  | ..   ||           |   ||  ||  | |           ||^** | |||||       | | | |                 ||| ||  |   || |   |  |   ^**        || ||    ||           |   ||  || || |     |  |        | |                   | |     || | |||      | ||     |  | ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                  |  | ..   |  |      |    |^***|||       | |                 |  ||  |               | |        |  | ..   ||           |   ||  ||  | |           |||   | |||||       | | | |                 |^***|  |   || |   ^***              || ||    ||           |   ||  || || |     |  |        | |                   | |     || | |||      | ||     |  | ||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  |  | ..   |  |      ^*****  |||||       | |                 |  ||  |               | |        |  | ..   ||           |   ||  ||  | |           |^***** |||||       | | | |                 | |  |  ^***** |                     || ||    ||           |   ||  || || |     |  |        | |                   | |     |^*****|      | ||     |  | ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                  |  | ..   |  |              |||||       | |                 |  ||  |               | |        |  | ..   ||           |   ||  ||  | |           | |     |||||       | | | |                 | |  |      |  |                     *****    ||           |   ||  || || |     |  |        | |                   | |     |  | | |      | ||     |  | ||         
search RasMol script viewer Motif-ligand binding stats  asxturn ..                  |  | ..   |  |              |||||       | |                 |  ||  |               | |        |  | ..   ||           |   ||  ||  ***           | |     |***|       | | | |                 | |  |      |  |                     || ||    ||           |   ||  |***| |     |  |        | |                   ***     |  | | |      ***|     |  ***|         
search RasMol script viewer Motif-ligand binding stats  betabulge ..                  |  | ..   |  |              |||||       | |                 |  ||  |               | |        |  | ..   **           |   ||  ||  |             | |     |||||       | | | |                 | |  |      |  |                     || ||    **           |   ||  |   | |     |  |        | |                           |  | | |      |  |     |  |  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  |  | ..   ****              |||||       | |                 |  ||  |               | |        |  | ..                |   ||  ||  |             | |     |||||       | | | |                 | |  |      |  |                     ****|                 |   |****   | |     |  |        | |                           |  | | |      |  |     |  |  |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  |  | ..   |  |              |||||       | |                 |  ||  |               | |        |  | ..                |   ||  ||  |             | |     |||||       | | ***                 | |  |      |  |                      |  |                 |   ||  |   | |     |  |        | |                           |  | | |      |  |     |  |  |         
search RasMol script viewer Motif-ligand binding stats  nest ..                  |  | ..   |  |              |****       | |                 |  ||  |               | |        |  | ..                |   ||  ||  |             | |     |****       ***                     | |  |      |  |                      |  |                 |   ||  |   ***     |  |        ***                           |  | | |      |  |     |  |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                  **** ..   ****              | |         ***                 ********               ***        **** ..                |   |********             ***     | |                                 ******      ****                      ****                 |   |****           ****                                      ********      ****     *******         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                       ..                     | |                                                                    ..                *****                             | |                                                                                            *****                                                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ..                     ***                                                                    ..                                                  ***                                                                                                                                                                                                 

   New search    4tr8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors