triangle PDBeMotif: 4tmu  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification hydrolase/dna    | release date: Mon, Jun 2, 2014
Title crystal structure of recq catalytic core from c. sakazakii b dna
Authors J.L.KECK, K.A.MANTHEI
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSSHHHHHHSSGLVPRGSHMAQAEVYSQETLAKQVLQETFGYQQFRPGQATIIDAVLEGRDCLVVMPTGGGKSLCYQIP
ALVKTGLTIVVSPLISLMKDQVDQLLANGVAAACLNSTQSREEQQAVLAGCRTGQVRLLYIAPERLMMDNFIDTLGYWDL
AMVAVDEAHCISQWGHDFRPEYAALGQLRARFPAVPFMALTATADDTTRRDIVRLLGLDDPLIEISSFDRPNIRYMLMEK
FKPLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSRGISAAAYHAGLEHEVRASVQEKFQRDDLQIVVATVAFGMGI
NKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKAPGPLQDIERHKLNAMGAFAEAQTC
RRLVLLNYFGEGRQAPCGNCDICLDPPRRYDGLVDAQKALSAIARVEQRFGMGYVVEVLRGANNQRIRELGHDKLKVYGI
GRDQSQEHWVSVIRQLIHLGVVTQNIAQHSALQLTEAARPFLRGEAPLMLAVPRVAALKPR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RECQ
member of: GENE3D:searchG3DSA_1.10.10.10/searchG3DSA_3.40.50.300PANTHER:searchPTHR13710/searchPTHR13710_SF70PFAM:searchPF00270/searchPF00271/searchPF09382PROSITE PROFILES:searchPS51192/searchPS51194, SMART:searchSM00487/searchSM00490/searchSM00956SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00614/searchTIGR01389UniProt:searchA7MQK9
JMol viewer RasMol script viewer  ZN 601A  ..                                                                                                                                                                                                                                                                                                                                                                                        *                *  *  *                                                                                                               
sec str:  ..hhhhhhhhhhhhhhhhh........hhhhhhhhhhh...eeee.......hhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhh...eee.....hhhhhhhhhhhhhh....eeeehhhhhhhhhhhhhhhh..eeeeee..hhhhhhhh...hhhhhhhhhhhhhh....eeeee...hhhhhhhhhhhhh....eeee.......eeeeeee..hhhhhhhhhhhhh....eeee..hhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhhh....eeee..............eeee.....hhhhhhhhhh........eeeeeeehhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhh..........hhhhhh...eeehhhhhhhhhhhhhhh....hhhhhhhhhh...hhhhhhhh.............hhhhhhhhhhhhhhh..eee.hhhh..eee..hhhhhhhh....eee...
sequence :  ..AEVYSQETLAKQVLQETFGYQQFRPGQATIIDAVLEGRDCLVVMPTGGGKSLCYQIPALVKTGLTIVVSPLISLMKDQVDQLLANGVAAACLNSTQSREEQQAVLAGCRTGQVRLLYIAPERLMMDNFIDTLGYWDLAMVAVDEAHCISQWGHDFRPEYAALGQLRARFPAVPFMALTATADDTTRRDIVRLLGLDDPLIEISSFDRPNIRYMLMEKFKPLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSRGISAAAYHAGLEHEVRASVQEKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKAPGPLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQAPCGNCDICLDPPRRYDGLVDAQKALSAIARVEQRFGMGYVVEVLRGANNQRIRELGHDKLKVYGIGRDQSQEHWVSVIRQLIHLGVVTQNIAQHSALQLTEAARPFLRGEAPLMLAVPR
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |   |         | |     | ||  ||| |||        |  | ||    |  |                     | ||| | | ^***|  ||    ||  ||||        |  |      |  |        | ||         |  |  |    ||  |     | | ||||| |    | |       || ||  |                    | |  |    |           || |||   | |  |      |  |   ||||     | |||    |            ||   ||  | ||| |||        ||||||                           |  | | |    || ||| | | | |            |    |        | | |         | |       |||| |  || |  ||   |         ||||            | |     ||||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |   |         | |     | ||  ||| |||        |  | ||    |  |                     | ||| | | |  ||  ||    ||  ||||        |  |      |  |        | ||         |  |  |    ||  |     | | ||^** |    | |       || ||  |                    | |  |    |           || |||   | |  |      |  |   ||||     | |||    |            ||   ||  ^**|| |||        ||||||                           |  | ^**    || ||| | | | |            |    |        | | |         | |       |||| |  || |  ||   |         ||||            | |     ||||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |   |         | |     | |^***|| |||        |  | ||    |  |                     | ||| | | |  |^***|    ||  ||||        |  |      |  |        | ||         |  |  |    ||  |     | ^*** ^***    | |       ^***|  |                    | |  |    |           || |||   | |  |      ^***   ||||     | |||    |            ||   ||  |  || |||        ||||||                           |  |        || ||| | | | |            |    |        | | |         | |       |||| |  || |  ||   |         ||||            | |     ||||        
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   |   |         | |     | |    || |||        |  | ||    |  |                     | ||| | | |  ||   |    ||  ||||        |  |      |  |        | ||         |  |  |    ||  |     | | |   |      | |        | ||  |                    | |  |    |           || |||   | |  |             ||||     | |||    |            ******^  |  || |||        ||||||                           |  |        || ||| | | | |            |    |        | | |         | |       |||| |  || |  ||   |         ||||            | |     ||||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |   |         | |     | |    || |||        ^*****|    |  |                     | |^***** |  ||   |    |^*****|        |  |      |  |        | ||         |  |  ^*****|  |     | | |   |      | |        | ||  |                    | |  ^*****           || |^***** |  |             ||||     | ||^*****             |   |   |  || |||        ||||||                           |  |        || ||| | | | |            ^*****        | | |         | |       |||| |  || |  ||   |         ||||            | |     ||||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |   |         | |     | |    || |||           |  |    |  |                     | ||| |   |  ||   |    |   ||||        |  |      |  |        | ||         |  |        |  |     | | |   |      | |        | ||  |                    | |                   || |||     |  |             ||||     | ||                   |   |   |  || |||        |*****                           |  |        || ||| | | | |                          | | |         | |       |||| |  || |  ||   |         ||||            | |     ||||        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |   |         | |     | |    || |||           |  |    |  |                     | ||| |   |  ||   |    |   ||||        |  |      |  |        | ||         |  |        |  |     | | *****      | |        | ||  |                    | |                   || |||     |  |             ||||     | ||                   *****   |  || |||        *****                            |  |        || ||| | | | |                          | | |         | |       |||| |  || |  ||   |         ||||            | |     ||||        
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |   |         | |     | |    || |||           |  |    |  |                     | ||| |   |  ||   |    |   ||||        |  |      |  |        | ||         |  |        |  |     | |            | |        | ||  |                    | |                   || |||     |  |             ||||     | ||                       |   |  || |||        ***||                            |  |        || ||| | | | |                          | | |         | |       |||| |  || |  ||   |         ||||            | |     ||||        
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |   |         | |     | |    |****|           ****    |  |                     ****| |   |  ||   |    |   ||||        |  |      ****        ****         ****        |  |     | |            | |        | ||  |                    | |                   |****|     |  |             ||||     | ||                       |   |  |****|        *****                            |  |        |****| | | | |                          | | |         | |       |||| |  || |  ||   |         ||||            | |     ||||        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |   |         | |     | |    |  | |                   |  |                       | ***   |  ||   |    |   ||||        |  |      |  |        | |                      |  |     | |            | |        | ||  |                    | |                   |  | |     |  |             ||||     | ||                       |   |  || | |                                         |  |        |  | | | | | |                          | | |         | |       |||| |  || |  ||   |         ||||            | |     ||||        
search RasMol script viewer Motif-ligand binding stats  nest ..   |   |         ***     ***    |  ***                   |  |                       ***     |  ||   |    |   ****        |  |      |  |        ***                      |  |     | |            ***        | ||  |                    ***                   |  ***     |  |             ****     | ||                       |   |  |*****                                         |  |        |  *** | | ***                          *****         ***       **** |  |***  ||   |         ****            | |     ****        
search RasMol script viewer Motif-ligand binding stats  niche ..   |   |                        |    |                   ****                               ****|   |    |   |***        ****      ****                                 ****     | |                       *******                                          |    |     ****                      ****                       |   ****                                              ****        |    | ***                                                        *******  ****|   |                         | |      ***        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..   |   |                        ******                                                          |   |    |   |                                                                   | |                       | |                                              ******                               | |                        |   |                                                             ******                                                                         |   |                         | |                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..   |   |                                                                                        *****    |   |                                                                   | |                       | |                                                                                   | |                        |   |                                                                                                                                            *****                         | |                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****                                                                                                 *****                                                                   | |                       | |                                                                                   | |                        *****                                                                                                                                                                          | |                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                 ***                       ***                                                                                   ***                                                                                                                                                                                                       ***                 

chain B : DNA (29-MER)
sec str:  .................................
sequence :  ..GTAGAATTG..AAATTCTACCGGTGCCTTAC
seq num:  ..3        ..14        24        

   New search    4tmu:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors