triangle PDBeMotif: 4ryl  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transferase    | release date: Mon, Dec 15, 2014
Title human protein arginine methyltransferase 3 in complex with 1 isoquinolin-6-yl-3-[2-oxo-2-(pyrrolidin-1-yl)ethyl]urea
Authors A.DONG, A.M.EDWARDS, B.L.ROTH, C.BOUNTRA, C.H.ARROWS, D.BARSYTE-LOVEJOY, D.SMIL, E.DOBROVETSKY, F.HE, F.LI, H.U.KANISKAN, I.ZANG, J.JIN, J.LIN-JONES, K.SCHMIDT, K.ZHAO, M.DAI, M.LANDON, M.S.ERAM, M.SC, M.SZEWCZYK, M.VEDADI, P.ATADJA, P.J.BROWN, S.J.MIN, S.KENNEDY, STRUCTURAL GENOMICS CONSORT, W.TE, X, X.LUO, X.P.HUANG, Y.LIN, Z.YU
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search 3ZG 3ZG binding statistics 3ZG   search UNX UNX binding statistics UNX
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSSHHHHHHSSGLVPRGSDLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM
FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKY
LAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISD
LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKD
PRSLTVTLTLNNSTQTYGLQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PRMT3 PROTEIN
member of: GENE3D:searchG3DSA_2.70.160.11/searchG3DSA_3.40.50.150PANTHER:searchPTHR11006/searchPTHR11006_SF45PFAM:searchPF06325PROSITE PROFILES:searchPS51678, SUPERFAMILY:searchSSF53335UniProt:searchQ8WUV3
JMol viewer RasMol script viewer  UNX 603A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                  
JMol viewer RasMol script viewer  UNX 602A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                  
JMol viewer RasMol script viewer  3ZG 601A  ..  *  **                                                                                                                                           *  **  *                       * * *                                         **                                   *                     ..3ZG ..                  
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee....hhhhhhhhhh...eeeeee..hhhhhhhhhhhhh.....eeeee............eeeee............hhhhhhhhhhhheeeeeeee..eeeeeeeee.hhhhhhhhhhhhhh.....hhhhhhhhh...eee..hhhhh....eeeeeee....hhhhhheeeeeeee....eeeeeeeeeeeeee.......eeee...........eeeeeeeeeeee....eeeeeeeee.... ....eeeeee..eeeeee..
sequence :  ..HYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHK... ..SLTVTLTLNNSTQTYGLQ
seq num:  ..243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513         ... ..531       541     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       |  | |   | ||     || || |     | |||||   || |||    | | |||        | |||| ||     || ||            | |  |||| | ||      |  ||  |                         |  ||  | |  |  ||  |       |  |      ||  ||| || || |     | |                  |  |      | |  | || |||         | |  |          ..PS00001..        ^***      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |  | |   ^**|     || || |     | |||||   || |||    | | |||        | |||| ||     || ||            | |  |||| | ||      |  ||  |                         |  ||  | |  |  ||  |       |  |      ||  ||| || || |     ^**                  |  |      | |  ^**| |||         ^**  |          ..PS00005..                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       |  | |   ^***     || || |     | |||||   || |||    | | |||        | |||| ||     || ||            | |  |||| ^***      |  ||  |                         |  ||  | |  |  ||  |       |  |      ||  ||| |^*** |                          |  |      | |  |  | |||           |  |          ..PS00006..                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       |  | |   |        || || |     ^*****|   || |||    ^*****|        | |||| ||     || ||            | |  |||| | |       |  ||  |                         |  ||  | |  |  ||  |       |  |      ||  ||| |  |  |                          |  |      | |  |  | |||           |  |          ..PS00008..                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       |  | |   |        ***** |     | |||||   || |||      | | |        | ||*****     *****            | |  |||| | |       |  ||  |                         |  ||  | |  *****  |       |  |      ||  ||| |  |  |                          |  |      | |  |  | |||           |  |          ..alphabetamotif..                  
search RasMol script viewer Motif-ligand binding stats  asxturn ..       |  | |   |        || || |     | |||||   || |||      *** |        | |||| ||     || ||            | |  |||| | |       |  ||  |                         |  ||  | |  |  ||  |       |  |      ||  *** |  |  |                          |  |      | |  |  | |||           |  |          ..asxturn..                  
search RasMol script viewer Motif-ligand binding stats  betabulge ..       |  | |   |        || || |     | |||||   || |||      | | |        | |||| ||     || ||            | |  |||| | |       |  ||  |                         |  ||  | |  |  ||  |       |  |      **  ||  |  |  |                          |  |      | |  |  | |||           |  |          ..betabulge..                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |  | |   |        *******     | |||||   |****|      | | |        ********|     ****|            | |  |||| | |       |  |****                         |  |**** *******|  |       |  |          ||  |  |  |                          ****      | |  |  ****|           ****          ..betaturn..                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |  | |   |         | || |     | |||||   |  | |      | | |          ||||  |      |  |            | |  ***| | |       |  |                             |  |            |  |       |  |          ||  |  |  |                          |  |      | |  |  | | |           |  |          ..gammaturn..                  
search RasMol script viewer Motif-ligand binding stats  nest ..       |  | |   |         | || |     *******   |  ***      | | |          ****  |      |  |            | |   ||| | |       |  |                             |  |            |  |       |  |          ||  |  |  |                          |  |      | |  |  | | |           |  |          ..nest..                  
search RasMol script viewer Motif-ligand binding stats  niche ..       **** |   |         ******               |    |      *** |             ****      ****            ***   ***** |       ****                             ****            ****       ****          |****  ****                          ****      ******  | | |           ****          ..niche..                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..            |   |                              ******        | |                                                 | |                                                                                 |   |                                          | |     | | |                         ..schellmannloop..                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..            |   |                                            | |                                                 | |                                                                                 |   |                                          | |     *****                         ..stmotif..                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****                                            | |                                                 | |                                                                                 *****                                          | |     | |                           ..ststaple..                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                             ***                                                 ***                                                                                                                                ***     ***                           ..stturn..                  

   New search    4ryl:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors