triangle PDBeMotif: 4ryd  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.75
Classification hydrolase/hydrolase inhibitor    | release date: Mon, Dec 15, 2014
Title x-ray structure of human furin in complex with the competiti inhibitor para-guanidinomethyl-phac-r-tle-r-amba
Authors M.E.THAN, S.O.DAHMS
Method X-RAY DIFFRACTION (resolution: 2.15Å)
PDBe Citation   
Small molecules:    search 2UC 2UC binding statistics 2UC   search FMT FMT binding statistics FMT   search CA CA binding statistics CA   search NA NA binding statistics NA
Modified residues:  search TBG TBG binding statistics TBG
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F sequence:
DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTASGSLVPRGSHHHH
HH
Chains H,I,J,K,L,N sequence:
RVRX
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FURIN
member of: GENE3D:searchG3DSA_2.10.220.10/searchG3DSA_2.60.120.260/searchG3DSA_3.40.50.200PANTHER:searchPTHR10795/searchPTHR10795_SF325PFAM:searchPF00082/searchPF01483PRINTS:searchSUBTILISINPROSITE PATTERNS:searchPS00136/searchPS00137/searchPS00138, SMART:searchSM00261SUPERFAMILY:searchSSF49785/searchSSF52743/searchSSF57184UniProt:searchP09958
JMol viewer RasMol script viewer  NA 607A  ..                                                                                                                                                                                                        * *  *                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CA 606A  ..                                                                 *    * *                                                                                                                               | |  |                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CA 605A  ..                                                                 |    | |                                                                                                                       *       | |  |                *                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  CA 604A  ..      *                                                          |    | |                       *  * * *                                                                                        |       | |  |                |                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  FMT 603A  ..      |                                                          |    | |                       |  | | |                                                              *                         |       | | *|                |                                                                                                                     *                                                                                                                         *   
JMol viewer RasMol script viewer  FMT 602A  ..      |                                                          |    | |                       |  | | |                                                              *                         |       | | *|                |                                                                                                                   * |                                                                                                                         |   
JMol viewer RasMol script viewer  FMT 601A  ..      |                                                          |    | |                       |  | | |                                                              |                         |       | | ||                |                                 **                                                                                | |                                                                                                                         |   
JMol viewer RasMol script viewer  2UC 1H  ..      |                                                          |    | |                       |  | | |                  **   *                   *          *       |                         |       | | ||                |                                 ||                                                                                | |                                                                                                                         |   
sec str:  ..........hhhhh...........hhhhhhhh.......eeeeee..............hhhhhee...............hhhhhhhhhhhhhhh...............eeeeee......hhhhhhhhhh.......eeee..............hhhhhhhhhhhhhhhhhhh..eeeee...hhhhh.hhhhh.......eeeeeee.................eeee.........eeeee...eeeeee.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..........ee.....ee.........hhhhhhhhhhhh......eeeeee.....ee...eeeeeeee...........eeeeeeeeeeeee.hhh.eeeeee.....eeeee...........eeeeeeee.........eeeeeeeee.......eeeeeeeeeeeee.
sequence :  ..VYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
seq num:  ..109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | | || |||  |  | |||||| || |||||||| ||| | | |  |  || |||| || | || | | |   | |||| ||    ||  |  |||| |   || |            |   |  | |||| ||       |   | ||              ||  |||| | |      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ^***|||  ||| ||||| | |  |    | |||| |   |  | | |   | ^***         | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |        ||||| || |        ^***|      ||      |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    | | || |||  |  | |||||| || |||||||| ||| | | |  |  || |||| || | || | | |   | |||| ||    ||  |  |||| |   || |            |   |  | |||| ||       |   | ||              ||  |||| | |      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||| |||  ||| ||||| | |  |    | **^* |   |  | | |   |  |           | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |        ||||| || |        | | |      ||      |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | | || |||  |  ^**||||| || |||||||| ||| | | |  |  || |||| || | || | | |   | |||| ||    ||  |  |||| |   || |            |   |  | |||| ||       |   | ||              ||  |||| | |      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||^**||  ||| ^**|| | |  |    | || | |   |  | | |   |  |           | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |        ||||| || |        | | |      ||      |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | | || |||  |  ^***|||| || |||||||| |^*** | |  |  || |||| || | || | | |   | |||| ||    ||  |  |||| |   || |            |   |  | |||| ||       |   | ||              ||  |||| | |      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||^***|  ||| ||||| | |  |    | || | |   |  | | |   |  |           | |     |  |       | |  |  | ^***            | ||     | |||   ||  |  | | |        |||^***| |        | | |      ||      |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | | || |||  |  | |||||| || ||||||^***** | ^*****  || |||| || | || | | |   | |||| |^*****|  |  |||| ^***** |            |   |  | ^*****|       |   | ||              ^*****^*****      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  ^*****    ||   ||  | |||   |  ||| ||||| | |  |    | || | |   ^***** |   |  |           | |     |  |       | |  |  |                 | ||     | |^*****|  |  | | |        ||||| || |        | | |      ||      ^**
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    | | || |||  |  | |||||| || |||||| | |   |   |  |  || |||| || | || | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||       |   | ||               |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | |||   |  ||| ||||| | |  |    ^*** | |      |   |   |  |           | |     ^***       | |  |  |                 | ||     | |||   ||  |  | | |        ||||| || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  RGD ..    | | || |||  |  | |||||| || |||||| | |   |   |  |  || |||| || | || | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||       |   | ||               |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | |||   |  ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 ***|     | |||   ||  |  | | |        ||||| || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..    | | || |||  |  | |||||| || |||||| | |   |   |  |  || |||| || | || | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||       ********               |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | |||   |  ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_ASP ..    | | || |||  |  | |||||| || |||||| | ****^*******  || |||| || | || | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | |||   |  ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_HIS ..    | | || |||  |  | |||||| || |||||| |     |   |  |  || |||| || | || | | |   | |||| ^**********  ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | |||   |  ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_SER ..    | | || |||  |  | |||||| || |||||| |     |   |  |  || |||| || | || | | |   | |||| |      |     ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  **^********|   ||  | |||   |  ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | | *****|  |  | |||||| || |||||| |     |   |  ********|| || | || | | |   | |||| |      |     ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |    |        |   ||  | |||   |  ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | | || |||  |  | |||||| || |||||| |     |   |  |  || |||| || | || | | |   | |||| |      |     ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |    |        |   ||  | |||   |  ||| ||||| | |  |    | |  | |      *****   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | | || |||  |  | |***|| || |||||| |     |   |  |  || |||| || ***| | | |   | |||| |      |     ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| ***  | ||      | ||| |  |  |  |        ***|            | |    |        |   ||  ***||   |  ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| |***        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  betabulge ..    | | || |||  |  | | |||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| |      |     ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        |  |            | |    |        |   ||  |  ||   |  ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     | |||   **  |  | | |        ||||| || |        | | |      **         
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    | | || |||  |  | | |||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| |      |     ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      ***** |  |  |  |        |  |            | |    |        |   ||  |  ||   |  ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     *****       |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | | *****|  |  | | |||| |****|||| |     |   |  *******|****|    | | | |   ****|| |      |     ||||     |  |            |   |  |  |****|           | |                |  |  | |        | ****|||| | |  | ||      ****| |  |  |  |        |  |            | |    |        |   ||  |  ||   |  ||| |||**** |  |    | |  | |              |  |           | |                | ****  |                 |  |     ****|       **** | |        |||****| |        | | |                 
search RasMol script viewer Motif-ligand binding stats  nest ..    | |      |  |  *** **** |  ****** |     |   |  |   |  | |  |    *** | |     **** |      |     ****     |  |            |   |  |  | |  |           ***                |  |  ***        |   ***||| | |  | ||        *** |  |  |  |        |  |            | |    |        |   ||  |  ||   |  ||| ||||| | |  |    ***  | |              |  |           | |                ***  |  |                 |  |       ***       |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  niche ..    ***      ****           |    | ****     |   ****   **** ****      *****          |      |      |       ****            |   |  **** ****                              ****             |      |**** *******            ****  ****        ****            | |    |        |   |*******|   |  ||********* ****         | |              ****           ***                  *******                 ****                 ****** |        |*********        *****                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                            ******          |                                        |      |      |                       |   |                                                          |      | |      | |                                               | |    |        |   |       |   |  ||  ||                   | |                                                                                                    | |        | |                 | |                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                            |                                        |      |      |                       *****                                                          |      | |      | |                                               | |    |        |   |       *****  ||  ||                   | |                                                                                                    | |        | |                 | |                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            |                                        |      |      |                                                                                      |      | |      | |                                               | |    |        *****              ******                   | |                                                                                                    | |        | |                 | |                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                            |                                        |      |      |                                                                                      |      ***      ***                                               ***    |                                                    ***                                                                                                    ***        ***                 ***                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                            *                                        *      *      *                                                                                      *                                                                        *                                                                                                                                                                                                              

chain H : PARA-GUANIDINOMETHYL-PHENYLACETYL-ARG-(3-METHYLVA(AMIDOMETHYL)BENZAMIDINE;
JMol viewer RasMol script viewer  CA 605A  ..    
JMol viewer RasMol script viewer  2UC 1H  ..*   
sec str:  ......
sequence :  ..RVRX
seq num:  ..2   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : FURIN
member of: GENE3D:searchG3DSA_2.10.220.10/searchG3DSA_2.60.120.260/searchG3DSA_3.40.50.200PANTHER:searchPTHR10795/searchPTHR10795_SF325PFAM:searchPF00082/searchPF01483PRINTS:searchSUBTILISINPROSITE PATTERNS:searchPS00136/searchPS00137/searchPS00138, SMART:searchSM00261SUPERFAMILY:searchSSF49785/searchSSF52743/searchSSF57184UniProt:searchP09958
JMol viewer RasMol script viewer  NA 607B  ..                                                                                                                                                                                                       * *  *                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CA 606B  ..                                                                *      *                                                                                                                               | |  |                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CA 605B  ..                                                                |      |                                                                            *                                          *       | |  |                *                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  CA 604B  ..     *                                                          |      |                       *  * * *                                             |                                          |       | |  |                |                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  FMT 602B  ..     |                                                          |      |                       |  | | |                                             |                *                         |       | | *|                |                                                                                                                     *                                                                                                                             
JMol viewer RasMol script viewer  FMT 601B  ..     |                                                          |      |                       |  | | |                                             |                |                         |       | | *|                |                                                                                                                   * |                                                                                                                             
JMol viewer RasMol script viewer  2UC 1I  ..     |                                                          |      |                       |  | | |                  **   *                   * |                |                         |       | | ||                |                                                                                                                   | |                                                                                                                             
sec str:  .........hhhhh...........hhhhhhhh.......eeeeee.........hhhhhhhhhhee...............hhhhhhhhhhhhhhh...............eeeeee......hhhhhhhhhh.......eeee..............hhhhhhhhhhhhhhhhhhh..eeeee..hhhhhh.hhhhh.......eeeeeee.................eeee.........eeeee...eeeeee.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..........ee.....ee.........hhhhhhhhhhhh......eeeeee.....ee...eeeeeeee...........eeeeeeeeeeeee.hhh.eeeeee.....eeeee...........eeeeeeee.........eeeeeeeee.......eeeeeeeeeeeee.
sequence :  ..YQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
seq num:  ..110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | | || ||      | |||||| || |||||||| ||| | | |  |  || ||||  |    | | | |   | |||| ||    ||  |  |||| |   || |            |   |  | |||| ||       |   | ||            | ||| |||| | |      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ^***||   ||| ||||| | |  |    | |||| |   |  | | |   | ^***         | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |         | || || |        ^***|      ||      |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | | || ||      | |||||| || |||||||| ||| | | |  |  || ||||  |    | | | |   | |||| ||    ||  |  |||| |   || |            |   |  | |||| ||       |   | ||            | ||| |||| | |      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||| ||   ||| ||||| | |  |    | **^* |   |  | | |   |  |           | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |         | || || |        | | |      ||      |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | | || ||      ^**||||| || |||||||| ||| | | |  |  || ||||  |    | | | |   | |||| ||    ||  |  |||| |   || |            |   |  | |||| ||       |   | ||            | ||| |||| | |      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||^**|   ||| ^**|| | |  |    | || | |   |  | | |   |  |           | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |         | || || |        | | |      ||      |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | | || ||      ^***|||| || |||||||| |^*** | |  |  || ||||  |    | | | |   | |||| ||    ||  |  |||| |   || |            |   |  | |||| ||       |   | ||            | ||| |||| | |      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||^***   ||| ||||| | |  |    | || | |   |  | | |   |  |           | |     |  |       | |  |  | ^***            | ||     | |||   ||  |  | | |         | ^***| |        | | |      ||      |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | | || ||      | |||||| || ||||||^***** | ^*****  || ||||  |    | | | |   | |||| |^*****|  |  |||| ^***** |            |   |  | ^*****|       |   | ||            | ^*****^*****      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  ^*****    ||   ||  | ||       ||| ||||| | |  |    | || | |   ^***** |   |  |           | |     |  |       | |  |  |                 | ||     | |^*****|  |  | | |         | || || |        | | |      ||      ^**
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   | | || ||      | |||||| || |||||| | |   |   |  |  || ||||  |    | | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||       |   | ||            |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    ^*** | |      |   |   |  |           | |     ^***       | |  |  |                 | ||     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  RGD ..   | | || ||      | |||||| || |||||| | |   |   |  |  || ||||  |    | | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||       |   | ||            |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 ***|     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..   | | || ||      | |||||| || |||||| | |   |   |  |  || ||||  |    | | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||       ********            |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_ASP ..   | | || ||      | |||||| || |||||| | ****^*******  || ||||  |    | | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_HIS ..   | | || ||      | |||||| || |||||| |     |   |  |  || ||||  |    | | | |   | |||| ^**********  ||||     |  |            |   |  |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_SER ..   | | || ||      | |||||| || |||||| |     |   |  |  || ||||  |    | | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  **^********|   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | | *****      | ||||***** |||||| |     |   |  ********||  |    | | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |    |        |   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | | || ||      | |||||| || |||||| |     |   |  |  || ||||  |    | | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |    |        |   ||  | ||       ||| ||||| | |  |    | |  | |      *****   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | | || ||      | |***|| || |||||| |     |   |  |  || ||||  |    | *** |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||           | |             |  || |  | |        |   | |||| ***  | ||      | ||| |  |  |  |        ***|            | |    |        |   ||  ***|       ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || |***        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | | || ||      | | |||| || |||||| |     |   |  |  || ||||  |    | | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        |  |            | |    |        |   ||  |  |       ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     | |||   **  |  | | |         | || || |        | | |      **         
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   | | || ||      | | |||| || |||||| |     |   |  |  || ||||  |    | | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      ***** |  |  |  |        |  |            | |    |        |   ||  |  |       ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     *****       |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | | *****      | | ||********|||| |     |   |  *******|||  |    | | | |   ****|| |      |  |  ||||     |  |            |   |  |  |****|           | |             |  || |  | |        |   | |||| | |  | ||      ****| |  |  |  |        |  |            | |    |        |   ||  |  |       ||| |||**** |  |    | |  | |              |  |           | |                | ****  |                 |  |     ****|       **** | |         | ****| |        | | |                 
search RasMol script viewer Motif-ligand binding stats  nest ..   | |            *** **** |  ****** |     |   |  |   |  |||  |    *** | |     **** |      |  |  ****     |  |            |   |  |  | |  |           ***             |  || |  ***        |   ***||| | |  | ||        *** |  |  |  |        |  |            | |    |        |   ||  |  |       ||| ||||| | |  |    ***  | |              |  |           | |                ***  |  |                 |  |       ***       |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  niche ..   ***                     |    | ****     |   ****   ****|****      *****          |      ****   |       ****            |   |  **** ****                           |  ****             |      |**** *******            ****  ****        ****            | |    |        |   |*******       ||********* ****         | |              ****           ***                  *******                 ****                 ****** |         *********        *****                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                           ******          |              |   |                     |      |      |                       |   |                                      |   |               |      | |      | |                                               | |    |        |   |              ||  ||                   | |                                                                                                    | |                            | |                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                           |              |   |                     |      |      |                       *****                                      |   |               |      | |      | |                                               | |    |        |   |              ||  ||                   | |                                                                                                    | |                            | |                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                           |              *****                     |      |      |                                                                  *****               |      | |      | |                                               | |    |        *****              ******                   | |                                                                                                    | |                            | |                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                           |                                        |      |      |                                                                                      |      ***      ***                                               ***    |                                                    ***                                                                                                    ***                            ***                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                           *                                        *      *      *                                                                                      *                                                                        *                                                                                                                                                                                                              

chain I : PARA-GUANIDINOMETHYL-PHENYLACETYL-ARG-(3-METHYLVA(AMIDOMETHYL)BENZAMIDINE;
JMol viewer RasMol script viewer  CA 605B  ..    
JMol viewer RasMol script viewer  2UC 1I  ..*   
sec str:  ......
sequence :  ..RVRX
seq num:  ..2   

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : FURIN
member of: GENE3D:searchG3DSA_2.10.220.10/searchG3DSA_2.60.120.260/searchG3DSA_3.40.50.200PANTHER:searchPTHR10795/searchPTHR10795_SF325PFAM:searchPF00082/searchPF01483PRINTS:searchSUBTILISINPROSITE PATTERNS:searchPS00136/searchPS00137/searchPS00138, SMART:searchSM00261SUPERFAMILY:searchSSF49785/searchSSF52743/searchSSF57184UniProt:searchP09958
JMol viewer RasMol script viewer  NA 607C  ..                                                                                                                                                                                                        * *  *                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CA 606C  ..                                                                 *    * *                                                                                                                               | |  |                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CA 605C  ..                                                                 |    | |                                                                            *                                          *       | |  |                *                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  CA 604C  ..      *                                                          |    | |                       *  * * *                                             |                                          |       | |  |                |                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  FMT 603C  ..      |                                                          |    | |                       |  | | |                                             |                *                         |       | | *|                |                                                                                                                     *                                                                                                                         *   
JMol viewer RasMol script viewer  FMT 602C  ..      |                                                          |    | |                       |  | | |                                             |                *                         |       | | ||                |                                                                                                                   * |                                                                                                                         |   
JMol viewer RasMol script viewer  FMT 601C  ..      |                                                          |    | |                       |  | | |                                             |                |                         |       | | ||             *  |                                 **                                                                                | |                                                                                                                         |   
JMol viewer RasMol script viewer  2UC 1J  ..      |                                                          |    | |                       |  | | |                  **   *                   * |        *       |                         |       | | ||             |  |                                 ||                                                                                | |                                                                                                                         |   
sec str:  ..........hhhhh...........hhhhhhhh.......eeeeee..............hhhhhee...............hhhhhhhhhhhhhhh...............eeeeee......hhhhhhhhhh.......eeee..............hhhhhhhhhhhhhhhhhhh..eeeee..hhhhhh.hhhhh.......eeeeeee.................eeee.........eeeee...eeeeee.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..........ee.....ee.........hhhhhhhhhhhh......eeeeee.....ee...eeeeeeee...........eeeeeeeeeeeee.hhh.eeeeee.....eeeee...........eeeeeeee.........eeeeeeeee.......eeeeeeeeeeeee.
sequence :  ..VYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
seq num:  ..109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | | || ||      | |||||| || |||||||| ||| | | |  |  || |||| || | || | | |   | |||| ||    ||  |  |||| |   || |                   | |||| ||       |   | ||            | ||| |||| | |      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ^***||   ||| ||||| | |  |    | |||| |   |  | | |   | ^***         | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |         | || || |        ^***|              |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    | | || ||      | |||||| || |||||||| ||| | | |  |  || |||| || | || | | |   | |||| ||    ||  |  |||| |   || |                   | |||| ||       |   | ||            | ||| |||| | |      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||| ||   ||| ||||| | |  |    | **^* |   |  | | |   |  |           | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |         | || || |        | | |              |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | | || ||      ^**||||| || |||||||| ||| | | |  |  || |||| || | || | | |   | |||| ||    ||  |  |||| |   || |                   | |||| ||       |   | ||            | ||| |||| | |      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||^**|   ||| ^**|| | |  |    | || | |   |  | | |   |  |           | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |         | || || |        | | |              |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | | || ||      ^***|||| || |||||||| |^*** | |  |  || |||| || | || | | |   | |||| ||    ||  |  |||| |   || |                   | |||| ||       |   | ||            | ||| |||| | |      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||^***   ||| ||||| | |  |    | || | |   |  | | |   |  |           | |     |  |       | |  |  | ^***            | ||     | |||   ||  |  | | |         | ^***| |        | | |              |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | | || ||      | |||||| || ||||||^***** | ^*****  || |||| || | || | | |   | |||| |^*****|  |  |||| ^***** |                   | ^*****|       |   | ||            | ^*****^*****      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  ^*****    ||   ||  | ||       ||| ||||| | |  |    | || | |   ^***** |   |  |           | |     |  |       | |  |  |                 | ||     | |^*****|  |  | | |         | || || |        | | |              ^**
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    | | || ||      | |||||| || |||||| | |   |   |  |  || |||| || | || | | |   | |||| |      |  |  ||||     |  |                   |  ||| ||       |   | ||            |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    ^*** | |      |   |   |  |           | |     ^***       | |  |  |                 | ||     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  RGD ..    | | || ||      | |||||| || |||||| | |   |   |  |  || |||| || | || | | |   | |||| |      |  |  ||||     |  |                   |  ||| ||       |   | ||            |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 ***|     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..    | | || ||      | |||||| || |||||| | |   |   |  |  || |||| || | || | | |   | |||| |      |  |  ||||     |  |                   |  ||| ||       ********            |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_ASP ..    | | || ||      | |||||| || |||||| | ****^*******  || |||| || | || | | |   | |||| |      |  |  ||||     |  |                   |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_HIS ..    | | || ||      | |||||| || |||||| |     |   |  |  || |||| || | || | | |   | |||| ^**********  ||||     |  |                   |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_SER ..    | | || ||      | |||||| || |||||| |     |   |  |  || |||| || | || | | |   | |||| |      |     ||||     |  |                   |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  **^********|   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | | *****      | ||||***** |||||| |     |   |  ********|| || | || | | |   | |||| |      |     ||||     |  |                   |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |    |        |   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | | || ||      | |||||| || |||||| |     |   |  |  || |||| || | || | | |   | |||| |      |     ||||     |  |                   |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |    |        |   ||  | ||       ||| ||||| | |  |    | |  | |      *****   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | | || ||      | |***|| || |||||| |     |   |  |  || |||| || ***| *** |   | |||| |      |     ||||     |  |                   |  ||| ||           | |             |  || |  | |        |   | |||| ***  | ||      | ||| |  |  |  |        ***|            | |    |        |   ||  ***|       ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || |***        | | |                 
search RasMol script viewer Motif-ligand binding stats  betabulge ..    | | || ||      | | |||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| |      |     ||||     |  |                   |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      | ||| |  |  |  |        |  |            | |    |        |   ||  |  |       ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     | |||   **  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    | | || ||      | | |||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| |      |     ||||     |  |                   |  ||| ||           | |             |  || |  | |        |   | |||| | |  | ||      ***** |  |  |  |        |  |            | |    |        |   ||  |  |       ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     *****       |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | | *****      | | ||********|||| |     |   |  *******|****|    | | | |   ****|| |      |     ||||     |  |                   |  |****|           | |             |  || |  | |        |   | |||| | |  | ||      ****| |  |  |  |        |  |            | |    |        |   ||  |  |       ||| |||**** |  |    | |  | |              |  |           | |                | ****  |                 |  |     ****|       **** | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  nest ..    | |            *** **** |  ****** |     |   |  |   |  |||  |    *** | |     **** |      |     ****     |  |                   |  | |  |           ***             |  || |  ***        |   ***||| | |  | ||        *** |  |  |  |        |  |            | |    |        |   ||  |  |       ||| ||||| | |  |    ***  | |              |  |           | |                ***  |  |                 |  |       ***       |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                     |    | ****     |   ****   ****|****      *****          |      |      |       ****                   **** ****                           |  ****             |      |**** *******            ****  ****        ****            | |    |        |   |*******       ||********* ****         | |              ****           ***                  *******                 ****                 ****** |         *********        *****                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                            ******          |              |   |                     |      |      |                                                                  |   |               |      | |      | |                                               | |    |        |   |              ||  ||                   | |                                                                                                    | |                            | |                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            |              *****                     |      |      |                                                                  *****               |      | |      | |                                               | |    |        *****              ******                   | |                                                                                                    | |                            | |                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                            |                                        |      |      |                                                                                      |      ***      ***                                               ***    |                                                    ***                                                                                                    ***                            ***                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                            *                                        *      *      *                                                                                      *                                                                        *                                                                                                                                                                                                              

chain J : PARA-GUANIDINOMETHYL-PHENYLACETYL-ARG-(3-METHYLVA(AMIDOMETHYL)BENZAMIDINE;
JMol viewer RasMol script viewer  CA 605C  ..    
JMol viewer RasMol script viewer  2UC 1J  ..*   
sec str:  ......
sequence :  ..RVRX
seq num:  ..2   

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : FURIN
member of: GENE3D:searchG3DSA_2.10.220.10/searchG3DSA_2.60.120.260/searchG3DSA_3.40.50.200PANTHER:searchPTHR10795/searchPTHR10795_SF325PFAM:searchPF00082/searchPF01483PRINTS:searchSUBTILISINPROSITE PATTERNS:searchPS00136/searchPS00137/searchPS00138, SMART:searchSM00261SUPERFAMILY:searchSSF49785/searchSSF52743/searchSSF57184UniProt:searchP09958
JMol viewer RasMol script viewer  NA 607D  ..                                                                                                                                                                                                       * *  *                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CA 606D  ..                                                                *    * *                                                                                                                               | |  |                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CA 605D  ..                                                                |    | |                                                                            *                                          *       | |  |                *                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  CA 604D  ..     *                                                          |    | |                       *  * * *                                             |                                          |       | |  |                |                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  FMT 603D  ..     |                                                          |    | |                       |  | | |                                             |                                          |       | |  |             *  |                                 **                                                                                                                                                                                                                
JMol viewer RasMol script viewer  FMT 602D  ..     |                                                          |    | |                       |  | | |                                             |                *                         |       | | *|             |  |                                 ||                                                                                  *                                                                                                                             
JMol viewer RasMol script viewer  FMT 601D  ..     |                                                          |    | |                       |  | | |                                             |                |                         |       | | *|             |  |                                 ||                                                                                * |                                                                                                                             
JMol viewer RasMol script viewer  2UC 1K  ..     |                                                          |    | |                       |  | | |                  **   *                   * |        *       |                         |       | | ||             |  |                                 ||                                                                                | |                                                                                                                             
sec str:  .........hhhhh...........hhhhhhhh.......eeeeee..............hhhhhee...............hhhhhhhhhhhhhhh...............eeeeee......hhhhhhhhhh.......eeee..............hhhhhhhhhhhhhhhhhhh..eeeee...hhhhh.hhhhh.......eeeeeee.................eeee.........eeeee...eeeeee.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..........ee.....ee.........hhhhhhhhhhhh......eeeeee.....ee...eeeeeeee...........eeeeeeeeeeeee.hhh.eeeeee.....eeeee...........eeeeeeee.........eeeeeeeee.......eeeeeeeeeeeee.
sequence :  ..YQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
seq num:  ..110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | | || ||      | |||||| || |||||||| ||| | | |  |  || |||| ||    | | | |   | |||| ||    ||  |  |||| |   || |               |   | |||| ||       |   | ||            | ||| |||||| |      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ^***||   ||| ||||| | |  |    | |||| |   |  | | |   | ^***         | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |        ||||| || |        ^***|              |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | | || ||      | |||||| || |||||||| ||| | | |  |  || |||| ||    | | | |   | |||| ||    ||  |  |||| |   || |               |   | |||| ||       |   | ||            | ||| |||||| |      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||| ||   ||| ||||| | |  |    | **^* |   |  | | |   |  |           | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |        ||||| || |        | | |              |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | | || ||      ^**||||| || |||||||| ||| | | |  |  || |||| ||    | | | |   | |||| ||    ||  |  |||| |   || |               |   | |||| ||       |   | ||            | ||| |||||| |      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||^**|   ||| ^**|| | |  |    | || | |   |  | | |   |  |           | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |        ||||| || |        | | |              |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | | || ||      ^***|||| || |||||||| |^*** | |  |  || |||| ||    | | | |   | |||| ||    ||  |  |||| |   || |               |   | |||| ||       |   | ||            | ||| |||||| |      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||^***   ||| ||||| | |  |    | || | |   |  | | |   |  |           | |     |  |       | |  |  | ^***            | ||     | |||   ||  |  | | |        |||^***| |        | | |              |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | | || ||      | |||||| || ||||||^***** | ^*****  || |||| ||    | | | |   | |||| |^*****|  |  |||| ^***** |               |   | ^*****|       |   | ||            | ^*****^*****      |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  ^*****    ||   ||  | ||       ||| ||||| | |  |    | || | |   ^***** |   |  |           | |     |  |       | |  |  |                 | ||     | |^*****|  |  | | |        ||||| || |        | | |              ^**
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   | | || ||      | |||||| || |||||| | |   |   |  |  || |||| ||    | | | |   | |||| |      |  |  ||||     |  |               |   |  ||| ||       |   | ||            |  || || |||        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    ^*** | |      |   |   |  |           | |     ^***       | |  |  |                 | ||     | |||   ||  |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  RGD ..   | | || ||      | |||||| || |||||| | |   |   |  |  || |||| ||    | | | |   | |||| |      |  |  ||||     |  |               |   |  ||| ||       |   | ||            |  || || |||        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 ***|     | |||   ||  |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..   | | || ||      | |||||| || |||||| | |   |   |  |  || |||| ||    | | | |   | |||| |      |  |  ||||     |  |               |   |  ||| ||       ********            |  || || |||        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_ASP ..   | | || ||      | |||||| || |||||| | ****^*******  || |||| ||    | | | |   | |||| |      |  |  ||||     |  |               |   |  ||| ||           | |             |  || || |||        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_HIS ..   | | || ||      | |||||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| ^**********  ||||     |  |               |   |  ||| ||           | |             |  || || |||        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_SER ..   | | || ||      | |||||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| |      |  |  ||||     |  |               |   |  ||| ||           | |             |  || || |||        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |  **^********|   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | | *****      | ||||***** |||||| |     |   |  ********|| ||    | | | |   | |||| |      |  |  ||||     |  |               |   |  ||| ||           | |             |  || || |||        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |    |        |   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | | || ||      | |||||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| |      |  |  ||||     |  |               |   |  ||| ||           | |             |  || || |||        |   | |||| | |  | ||      | ||| |  |  |  |        | ||            | |    |        |   ||  | ||       ||| ||||| | |  |    | |  | |      *****   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | | || ||      | |***|| || |||||| |     |   |  |  || |||| ||    | *** |   | |||| |      |  |  ||||     |  |               |   |  ||| ||           | |             |  || || |||        |   | |||| ***  | ||      | ||| |  |  |  |        ***|            | |    |        |   ||  ***|       ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |        ||||| |***        | | |                 
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | | || ||      | | |||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| |      |  |  ||||     |  |               |   |  ||| ||           | |             |  || || |||        |   | |||| | |  | ||      | ||| |  |  |  |        |  |            | |    |        |   ||  |  |       ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     | |||   **  |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   | | || ||      | | |||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| |      |  |  ||||     |  |               |   |  ||| ||           | |             |  || || |||        |   | |||| | |  | ||      ***** |  |  |  |        |  |            | |    |        |   ||  |  |       ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     *****       |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | | *****      | | ||********||****     |   |  *******|****|    | | | |   ****|| |      |  |  ||||     |  |               |   |  |****|           | |             |  || |****|        |   | |||| | |  | ||      ****| |  |  |  |        |  |            | |    |        |   ||  |  |       ||| |||**** |  |    | |  | |              |  |           | |                | ****  |                 |  |     ****|       **** | |        |||****| |        | | |                 
search RasMol script viewer Motif-ligand binding stats  nest ..   | |            *** **** |  ****** |     |   |  |   |  |||  |    *** | |     **** |      |  |  ****     |  |               |   |  | |  |           ***             |  || |  ***        |   ***||| | |  | ||        *** |  |  |  |        |  |            | |    |        |   ||  |  |       ||| ||||| | |  |    ***  | |              |  |           | |                ***  |  |                 |  |       ***       |  | | |        ||||| || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  niche ..   ***                     |    | ****     |   ****   ****|****      *****          |      ****   |       ****               |   **** ****                           |  ****             |      |**** *******            ****  ****        ****            | |    |        |   |*******       ||********* ****         | |              ****           ***                  *******                 ****                 ****** |        |*********        *****                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                           ******          |              |   |                     |      |      |                          |   |                                   |   |               |      | |      | |                                               | |    |        |   |              ||  ||                   | |                                                                                                    | |        | |                 | |                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                           |              *****                     |      |      |                          *****                                   *****               |      | |      | |                                               | |    |        *****              ******                   | |                                                                                                    | |        | |                 | |                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                           |                                        |      |      |                                                                                      |      ***      ***                                               ***    |                                                    ***                                                                                                    ***        ***                 ***                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                           *                                        *      *      *                                                                                      *                                                                        *                                                                                                                                                                                                              

chain K : PARA-GUANIDINOMETHYL-PHENYLACETYL-ARG-(3-METHYLVA(AMIDOMETHYL)BENZAMIDINE;
JMol viewer RasMol script viewer  CA 605D  ..    
JMol viewer RasMol script viewer  2UC 1K  ..*   
sec str:  ......
sequence :  ..RVRX
seq num:  ..2   

Assembly 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : FURIN
member of: GENE3D:searchG3DSA_2.10.220.10/searchG3DSA_2.60.120.260/searchG3DSA_3.40.50.200PANTHER:searchPTHR10795/searchPTHR10795_SF325PFAM:searchPF00082/searchPF01483PRINTS:searchSUBTILISINPROSITE PATTERNS:searchPS00136/searchPS00137/searchPS00138, SMART:searchSM00261SUPERFAMILY:searchSSF49785/searchSSF52743/searchSSF57184UniProt:searchP09958
JMol viewer RasMol script viewer  NA 607E  ..                                                                                                                                                                                                       * *  *                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CA 606E  ..                                                                *    * *                                                                                                                               | |  |                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CA 605E  ..                                                                |    | |                                                                            *                                          *       | |  |                *                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  CA 604E  ..     *                                              *           |    | |                       *    * *                                             |                                          |       | |  |                |                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  FMT 603E  ..     |                                              |           |    | |                       |    | |                                             |                *                         |       | | *|                |                                                                                                                     *                                                                                                                         *   
JMol viewer RasMol script viewer  FMT 602E  ..     |                                              |           |    | |                       |    | |                                             |                *                         |       | | *|                |                                                          *                                                        * |                                                                                                                         |   
JMol viewer RasMol script viewer  FMT 601E  ..     |                                              |           |    | |                       |    | |                                             |                |                         |       | | ||                |                                 **                       |                                                        | |                                                                                                                         |   
JMol viewer RasMol script viewer  2UC 1L  ..     |                                              |           |    | |                       |    | |                  **   *                   * |                |                         |       | | ||                |                                 ||                       |                                                        | |                                                                                                                         |   
sec str:  .........hhhhh...........hhhhhhhh.......eeeeee..............hhhhhee...............hhhhhhhhhhhhhhh...............eeeeee......hhhhhhhhhh.......eeee..............hhhhhhhhhhhhhhhhhhh..eeeee...hhhhh.hhhhh.......eeeeeee.................eeee.........eeeee...eeeeee.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..........ee.....ee.........hhhhhhhhhhhh......eeeeee.....ee...eeeeeeee...........eeeeeeeeeeeee.hhh.eeeeee.....eeeee...........eeeeeeee.........eeeeeeeee.......eeeeeeeeeeeee.
sequence :  ..YQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
seq num:  ..110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | | || ||      | |||||| || |||||||| ||| | | |  |  || |||| || | || | | |   | |||| ||    ||  |  |||| |   || |            |  ||  | |||| ||       |   | ||              ||  |||| | |      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ^***||    || ||||| | |  |    | |||| |   |  | | |   | ^***         | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |         | || || |        ^***|              |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | | || ||      | |||||| || |||||||| ||| | | |  |  || |||| || | || | | |   | |||| ||    ||  |  |||| |   || |            |  ||  | |||| ||       |   | ||              ||  |||| | |      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||| ||    || ||||| | |  |    | **^* |   |  | | |   |  |           | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |         | || || |        | | |              |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | | || ||      ^**||||| || |||||||| ||| | | |  |  || |||| || | || | | |   | |||| ||    ||  |  |||| |   || |            |  ||  | |||| ||       |   | ||              ||  |||| | |      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||^**|    || ^**|| | |  |    | || | |   |  | | |   |  |           | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |         | || || |        | | |              |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | | || ||      ^***|||| || |||||||| |^*** | |  |  || |||| || | || | | |   | |||| ||    ||  |  |||| |   || |            |  ||  | |||| ||       |   | ||              ||  |||| | |      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||^***    ||  |||| | |  |    | || | |   |  | | |   |  |           | |     |  |       | |  |  | ^***            | ||     | |||   ||  |  | | |         | ^***| |        | | |              |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | | || ||      | |||||| || ||||||^***** | ^*****  || |||| || | || | | |   | |||| |^*****|  |  |||| ^***** |            |  ||  | ^*****|       |   | ||              ^*****^*****      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  ^*****    ||   ||  | ||        ||  |||| | |  |    | || | |   ^***** |   |  |           | |     |  |       | |  |  |                 | ||     | |^*****|  |  | | |         | || || |        | | |              ^**
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   | | || ||      | |||||| || |||||| | |   |   |  |  || |||| || | || | | |   | |||| |      |  |  ||||     |  |            |  ||  |  ||| ||       |   | ||               |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||        ||  |||| | |  |    ^*** | |      |   |   |  |           | |     ^***       | |  |  |                 | ||     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  RGD ..   | | || ||      | |||||| || |||||| | |   |   |  |  || |||| || | || | | |   | |||| |      |  |  ||||     |  |            |  ||  |  ||| ||       |   | ||               |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||        ||  |||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 ***|     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..   | | || ||      | |||||| || |||||| | |   |   |  |  || |||| || | || | | |   | |||| |      |  |  ||||     |  |            |  ||  |  ||| ||       ********               |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||        ||  |||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_ASP ..   | | || ||      | |||||| || |||||| | ****^*******  || |||| || | || | | |   | |||| |      |  |  ||||     |  |            |  ||  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||        ||  |||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_HIS ..   | | || ||      | |||||| || |||||| |     |   |  |  || |||| || | || | | |   | |||| ^**********  ||||     |  |            |  ||  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||        ||  |||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_SER ..   | | || ||      | |||||| || |||||| |     |   |  |  || |||| || | || | | |   | |||| |      |     ||||     |  |            |  ||  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  **^********|   ||  | ||        ||  |||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | | *****      | ||||***** |||||| |     |   |  ********|| || | || | | |   | |||| |      |     ||||     |  |            |  ||  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |    |        |   ||  | ||        ||  |||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | | || ||      | |||||| || |||||| |     |   |  |  || |||| || | || | | |   | |||| |      |     ||||     |  |            |  ||  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |    |        |   ||  | ||        ||  |||| | |  |    | |  | |      *****   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | | || ||      | |***|| || |||||| |     |   |  |  || |||| || ***| *** |   | |||| |      |     ||||     |  |            |  ||  |  ||| ||           | |                |  |  | |        | | |||||| ***  | ||      | ||| |  |  |  |        ***|            | |    |        |   ||  ***|        ||  |||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | | || ||      | | |||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| |      |     ||||     |  |            |  ||  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        |  |            | |    |        |   ||  |  |        ||  |||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     | |||   **  |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   | | || ||      | | |||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| |      |     ||||     |  |            |  ||  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      ***** |  |  |  |        |  |            | |    |        |   ||  |  |        ||  |||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     *****       |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | | *****      | | ||********||****     |   |  *******|****|    | | | |   ****|| |      |     ||||     |  |            |  ||  |  |****|           | |                |  |  | |        | ****|||| | |  | ||      ****| |  |  |  |        |  |            | |    |        |   ||  |  |        ||  ||**** |  |    | |  | |              |  |           | |                | ****  |                 |  |     ****|       **** | |         | ****| |        | | |                 
search RasMol script viewer Motif-ligand binding stats  nest ..   | |            *** **** |  ****** |     |   |  |   |  |||  |    *** | |     **** |      |     ****     |  |            |  ||  |  | |  |           ***                |  |  ***        |   ***||| | |  | ||        *** |  |  |  |        |  |            | |    |        |   ||  |  |        ||  |||| | |  |    ***  | |              |  |           | |                ***  |  |                 |  |       ***       |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  niche ..   ***                     |    | ****     |   ****   ****|****      *****          |      |      |       ****            |  ||  **** ****                              ****             |      |**** *******            ****  ****        ****            | |    |        |   |*******        |********* ****         | |              ****           ***                  *******                 ****                 ****** |         *********        *****                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                           ******          |              |   |                     |      |      |                       |  ||  |                                                       |      | |      | |                                               | |    |        |   |               |   |                   | |                                                                                                    | |                            | |                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                           |              |   |                     |      |      |                       *****  |                                                       |      | |      | |                                               | |    |        |   |               |   |                   | |                                                                                                    | |                            | |                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                           |              *****                     |      |      |                          *****                                                       |      | |      | |                                               | |    |        *****               *****                   | |                                                                                                    | |                            | |                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                           |                                        |      |      |                                                                                      |      ***      ***                                               ***    |                                                    ***                                                                                                    ***                            ***                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                           *                                        *      *      *                                                                                      *                                                                        *                                                                                                                                                                                                              

chain L : PARA-GUANIDINOMETHYL-PHENYLACETYL-ARG-(3-METHYLVA(AMIDOMETHYL)BENZAMIDINE;
JMol viewer RasMol script viewer  CA 605E  ..    
JMol viewer RasMol script viewer  2UC 1L  ..*   
sec str:  ......
sequence :  ..RVRX
seq num:  ..2   

Assembly 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain F : FURIN
member of: GENE3D:searchG3DSA_2.10.220.10/searchG3DSA_2.60.120.260/searchG3DSA_3.40.50.200PANTHER:searchPTHR10795/searchPTHR10795_SF325PFAM:searchPF00082/searchPF01483PRINTS:searchSUBTILISINPROSITE PATTERNS:searchPS00136/searchPS00137/searchPS00138, SMART:searchSM00261SUPERFAMILY:searchSSF49785/searchSSF52743/searchSSF57184UniProt:searchP09958
JMol viewer RasMol script viewer  NA 607F  ..                                                                                                                                                                                                       * *  *                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CA 606F  ..                                                                *    * *                                                                                                                               | |  |                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  CA 605F  ..                                                                |    | |                                                                            *                                          *       | |  |                *                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  CA 604F  ..     *                                                          |    | |                       *  * * *                                             |                                          |       | |  |                |                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  FMT 603F  ..     |                                                          |    | |                       |  | | |                                             |                                          |       | |  |             *  |                                 **                                                                                                                                                                                                                
JMol viewer RasMol script viewer  FMT 602F  ..     |                                                          |    | |                       |  | | |                                             |                *                         |       | | *|             |  |                                 ||                                                                                  *                                                                                                                         *   
JMol viewer RasMol script viewer  FMT 601F  ..     |                                                          |    | |                       |  | | |                                             |                |                         |       | | *|             |  |                                 ||                       *                                                        * |                                                                                                                         |   
JMol viewer RasMol script viewer  2UC 1N  ..     |                                                          |    | |                       |  | | |                  **   *                   * |                |                         |       | | ||             |  |                                 ||                       |                                                        | |                                                                                                                         |   
sec str:  .........hhhhh...........hhhhhhhh.......eeeeee.........hhhhhhhhhhee...............hhhhhhhhhhhhhhh...............eeeeee......hhhhhhhhhh.......eeee..............hhhhhhhhhhhhhhhhhhh..eeeee...hhhhh.hhhhh.......eeeeeee.................eeee.........eeeee...eeeeee.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..........ee.....ee.........hhhhhhhhhhhh......eeeeee.....ee...eeeeeeee...........eeeeeeeeeeeee.hhh.eeeeee.....eeeee...........eeeeeeee.........eeeeeeeee.......eeeeeeeeeeeee.
sequence :  ..YQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
seq num:  ..110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | | || ||      | |||||| || |||||||| ||| | | |  |  || ||||||| | || | | |   | |||| ||    ||  |  |||| |   || |            |   |  | |||| ||       |   | ||              ||  |||| | |      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ^***||   ||| ||||| | |  |    | |||| |   |  | | |   | ^***         | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |         | || || |        ^***|      ||      |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | | || ||      | |||||| || |||||||| ||| | | |  |  || ||||||| | || | | |   | |||| ||    ||  |  |||| |   || |            |   |  | |||| ||       |   | ||              ||  |||| | |      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||| ||   ||| ||||| | |  |    | **^* |   |  | | |   |  |           | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |         | || || |        | | |      ||      |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | | || ||      ^**||||| || |||||||| ||| | | |  |  || ||||||| | || | | |   | |||| ||    ||  |  |||| |   || |            |   |  | |||| ||       |   | ||              ||  |||| | |      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||^**|   ||| ^**|| | |  |    | || | |   |  | | |   |  |           | |     |  |       | |  |  | |  |            | ||     | |||   ||  |  | | |         | || || |        | | |      ||      |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | | || ||      ^***|||| || |||||||| |^*** | |  |  || ||||||| | || | | |   | |||| ||    ||  |  |||| |   || |            |   |  | |||| ||       |   | ||              ||  |||| | |      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |  |    ||   ||  | ||^***   ||| ||||| | |  |    | || | |   |  | | |   |  |           | |     |  |       | |  |  | ^***            | ||     | |||   ||  |  | | |         | ^***| |        | | |      ||      |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | | || ||      | |||||| || ||||||^***** | ^*****  || ||||||| | || | | |   | |||| |^*****|  |  |||| ^***** |            |   |  | ^*****|       |   | ||              ^*****^*****      | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  ^*****    ||   ||  | ||       ||| ||||| | |  |    | || | |   ^***** |   |  |           | |     |  |       | |  |  |                 | ||     | |^*****|  |  | | |         | || || |        | | |      ||      ^**
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   | | || ||      | |||||| || |||||| | |   |   |  |  || ||||||| | || | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||       |   | ||               |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    ^*** | |      |   |   |  |           | |     ^***       | |  |  |                 | ||     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  RGD ..   | | || ||      | |||||| || |||||| | |   |   |  |  || ||||||| | || | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||       |   | ||               |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 ***|     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..   | | || ||      | |||||| || |||||| | |   |   |  |  || ||||||| | || | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||       ********               |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_ASP ..   | | || ||      | |||||| || |||||| | ****^*******  || ||||||| | || | | |   | |||| |      |  |  ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_HIS ..   | | || ||      | |||||| || |||||| |     |   |  |  || ||||||| | || | | |   | |||| ^**********  ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  | |       ||   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  SUBTILASE_SER ..   | | || ||      | |||||| || |||||| |     |   |  |  || ||||||| | || | | |   | |||| |      |     ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |  **^********|   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | | *****      | ||||***** |||||| |     |   |  ********||||| | || | | |   | |||| |      |     ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |    |        |   ||  | ||       ||| ||||| | |  |    | |  | |      |   |   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | | || ||      | |||||| || |||||| |     |   |  |  || ||***** | || | | |   | |||| |      |     ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        | ||            | |    |        |   ||  | ||       ||| ||||| | |  |    | |  | |      *****   |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || || |        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | | || ||      | |***|| || |||||| |     |   |  |  || ||***|| ***| *** |   | |||| |      |     ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| ***  | ||      | ||| |  |  |  |        ***|            | |    |        |   ||  ***|       ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     | |||   ||  |  | | |         | || |***        | | |      ||         
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | | || ||      | | |||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| |      |     ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      | ||| |  |  |  |        |  |            | |    |        |   ||  |  |       ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     | |||   **  |  | | |         | || || |        | | |      **         
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   | | || ||      | | |||| || |||||| |     |   |  |  || |||| ||    | | | |   | |||| |      |     ||||     |  |            |   |  |  ||| ||           | |                |  |  | |        | | |||||| | |  | ||      ***** |  |  |  |        |  |            | |    |        |   ||  |  |       ||| ||||| | |  |    | |  | |              |  |           | |                | |  |  |                 |  |     *****       |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | | *****      | | ||********|||| |     |   |  *******|****|    | | | |   ****|| |      |     ||||     |  |            |   |  |  |****|           | |                |  |  | |        | ****|||| | |  | ||      ****| |  |  |  |        |  |            | |    |        |   ||  |  |       ||| |||**** |  |    | |  | |              |  |           | |                | ****  |                 |  |     ****|       **** | |         | ****| |        | | |                 
search RasMol script viewer Motif-ligand binding stats  nest ..   | |            *** **** |  ****** |     |   |  |   |  |||  |    *** | |     **** |      |     ****     |  |            |   |  |  | |  |           ***                |  |  ***        |   ***||| | |  | ||        *** |  |  |  |        |  |            | |    |        |   ||  |  |       ||| ||||| | |  |    ***  | |              |  |           | |                ***  |  |                 |  |       ***       |  | | |         | || || |        | | |                 
search RasMol script viewer Motif-ligand binding stats  niche ..   ***                     |    | ****     |   ****   ****|****      *****          |      |      |       ****            |   |  **** ****                              ****             |      |**** *******            ****  ****        ****            | |    |        |   |*******       ||********* ****         | |              ****           ***                  *******                 ****                 ****** |         *********        *****                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                           ******          |              |   |                     |      |      |                       |   |                                                          |      | |      | |                                               | |    |        |   |              ||  ||                   | |                                                                                                    | |                            | |                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                           |              |   |                     |      |      |                       *****                                                          |      | |      | |                                               | |    |        |   |              ||  ||                   | |                                                                                                    | |                            | |                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                           |              *****                     |      |      |                                                                                      |      | |      | |                                               | |    |        *****              ******                   | |                                                                                                    | |                            | |                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                           |                                        |      |      |                                                                                      |      ***      ***                                               ***    |                                                    ***                                                                                                    ***                            ***                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                           *                                        *      *      *                                                                                      *                                                                        *                                                                                                                                                                                                              

chain N : PARA-GUANIDINOMETHYL-PHENYLACETYL-ARG-(3-METHYLVA(AMIDOMETHYL)BENZAMIDINE;
JMol viewer RasMol script viewer  CA 605F  ..    
JMol viewer RasMol script viewer  2UC 1N  ..*   
sec str:  ......
sequence :  ..RVRX
seq num:  ..2   

   New search    4ryd:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors