triangle PDBeMotif: 4rg7  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Mon, Sep 29, 2014
Title crystal structure of apc3
Authors B.A.SCHULMAN, D.J.MILLER, M.YAMAGUCHI, S.YU
Method X-RAY DIFFRACTION (resolution: 4.25Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GSMTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKC
CVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEI
GEKPDPDQTFKFTSLQNFSNCLPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQ
IGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHD
IAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDI
NPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIG
KVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CELL DIVISION CYCLE PROTEIN 27 HOMOLOG
member of: GENE3D:searchG3DSA_1.25.40.120PANTHER:searchPTHR12558/searchPTHR12558_SF11PFAM:searchPF07719/searchPF12895PROSITE PROFILES:searchPS50005/searchPS50293, SMART:searchSM00028SUPERFAMILY:searchSSF48452UniProt:searchP30260
sec str:  ..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhhhhh.hhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhh...... ...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh... ...hhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..
sequence :  ..QEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFT... ..KAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHAL... ..TLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDP
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165    ... ..462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682    ... ..697       707       717       727       737       747       757       767     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          || |||              | |    |   |    | |       |  | | |             | |        ||||  |  | ||  |      |   |    |   | |        |  || | || |  ||  || |  | |||||  ..PS00001..                   |  | |    |  || |   |  | |      |    | ||   |   |     ||||             | |       |   |  |          |    || |              | ||             | |           |  |  |           | ||| |  |           | |             ..PS00001..        |  |          |  |             |  |  |          |  |||      ^*** |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          || |||              | |    |   |    ^**       |  | | |             | |        ||||  |  | ||  |      |   |    |   ^**        |  || | || |  ||  || |  | ||^**  ..PS00005..                   |  | |    |  || |   |  | |      |    | ||   |   |     ||||             | |       |   |  |          |    || |              | ||             | |           |  |  |           | ||| |  |           | |             ..PS00005..        |  |          |  |             |  |  |          |  |||           |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          || |||              | |    |   |    | |       |  | | |             | |        ||||  |  ^***  |      |   |    |   | |        |  || | || ^***^***| |  | ||||   ..PS00006..                   |  | |    |  || |   |  | |      |    | ||   |   |     ||||             | |       |   ^***          |    || |              | ||             | |           |  |  |           | ||| ^***           | |             ..PS00006..        |  |          |  |             |  |  |          |  |||           |  | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          || |||              | |    |   |    | |       |  | | |             | |        ||||  |    |   |      |   |    |   | |        |  || | ||         | |  | ||||   ..PS00007..                   |  | |    |  || |   |  | |      ********^   |   |     ||||             | |       |   |             |    || |              | ||             | |           |  |  |           | |||                | |             ..PS00007..        |  |          |  |             |  |  |          |  |||           |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          || |||              | |    |   |    | |       |  | | |             | |        |^*****    |   |      |   |    |   | |        |  || | ||         | |  | ||||   ..PS00008..                   |  | |    |  || |   |  | |           | |    |   |     ||||             | |       |   |             ^*****| |              | ||             | |           |  |  |           | |||                | |             ..PS00008..        |  |          |  |             |  |  |          |  |||           |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          || |||              | |    |   |    | |       |  | | |             | |        ||||       |   |      |   |    |   | |        |  || | ||         | |  *****|   ..alphabetamotif..                   |  | |    |  || |   |  | |           | |    |   |     ||||             | |       |   |                   | |              | ||             | |           |  |  |           | |||                | |             ..alphabetamotif..        |  |          |  |             |  |  |          *****|           |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..          || |||              | |    |   |    | |       |  | | |             | |        ||||       |   |      |   |    |   | |        |  || ***|         | |  | || |   ..asxturn..                   |  | |    |  || |   |  | |           | |    |   |     ||||             | |       |   |                   | |              ***|             | |           |  |  |           | |||                | |             ..asxturn..        |  |          |  |             |  |  |          |  | |           |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |****|              | |    |   |    | |       |  | | |             | |        ||||       |   |      |   |    |   | |        |  || |  |         | |  **** |   ..betaturn..                   |  | |    |  || |   |  | |           | |    |   |     ||||             | |       |   |                   | |              |  |             | |           |  |  |           ****|                | |             ..betaturn..        |  |          |  |             |  |  |          **** |           |  | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          |  | |              | |    |   |    | |       |  | | |             | |        ||||       |   |      |   |    |   | |        |  || |  |         | |    |  |   ..gammaturn..                   |  ***    |  || |   |  | |           | |    |   |     ||||             | |       |   |                   | |              |  |             | |           |  |  |             | |                | |             ..gammaturn..        |  |          |  |             |  |  |             | |           |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..          |  ***              | |    |   |    ***       |  | | |             ***        ****       |   |      |   |    |   ***        |  || |  |         ***    |  |   ..nest..                   |  |      |  || |   |  | |           ***    |   |     ****             ***       |   |                   ***              |  |             ***           |  |  |             ***                ***             ..nest..        |  |          |  |             |  |  |             ***           |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..          |    |              ***    |   |              **** ***                                   |   |      |   |    |   |          |  *******                ****   ..niche..                   ****      |  ****   **** |                  |   |      ***                       |   |                                    ****                           *******                                                ..niche..        ****          ****             *******                           **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..          ******                     |   |                                                         |   |      |   |    |   |          |   |                            ..schellmannloop..                             |   |        | |                  |   |                                |   |                                                                                                                          ..schellmannloop..                                                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                     *****                                                         *****      *****    *****          *****                            ..ststaple..                             *****        | |                  *****                                *****                                                                                                                          ..ststaple..                                                                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                       ..stturn..                                          ***                                                                                                                                                                                      ..stturn..                                                                              

chain B : CELL DIVISION CYCLE PROTEIN 27 HOMOLOG
member of: GENE3D:searchG3DSA_1.25.40.120PANTHER:searchPTHR12558/searchPTHR12558_SF11PFAM:searchPF07719/searchPF12895PROSITE PROFILES:searchPS50005/searchPS50293, SMART:searchSM00028SUPERFAMILY:searchSSF48452UniProt:searchP30260
sec str:  ...hhhhhhhhhhhh.hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhhhhhh....hhhhhh...... ...hhhhhhhhhhhhhhhhhhh.hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh......hhhhhhhhhhh.hhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh... ....hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.
sequence :  ..EPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFT... ..AEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHA... ..TLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDP
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166   ... ..465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615       625       635       645       655       665       675          ... ..697       707       717       727       737       747       757       767     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          | |||              | |             | |       |  | |            |  | |      |  |    |  |  |    |  |              | ||   |      |  | || |  ||  || |     || |  ..PS00001..                   | |       |  |   |  |        |    | ||             |  |||||||   |             |   |  |  |       |    || |           |  |            | | |||           |  |  |             | | |  |                          ..PS00001..                      |  |             |  |             |  ||       ^***      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | |||              | |             ^**       |  | |            |  | |      |  |    |  |  |    |  |              ^**|   |      |  | || |  ||  || |     |^**  ..PS00005..                   | |       |  |   |  |        |    | ||             |  |||||||   |             |   |  |  |       |    || |           |  |            | | |||           |  |  |             | | |  |                          ..PS00005..                      |  |             |  |             |  ||                 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | |||              | |             | |       |  | |            |  | |      |  |    |  ^***    |  |                 |   |      |  | || ^***^***| |     |  |  ..PS00006..                   | |       |  |   |  |        |    | ||             |  |||||||   |             |   ^***  |       |    || |           |  |            | | |||           |  |  |             | | ^***                          ..PS00006..                      |  |             |  |             |  ||                 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          | |||              | |             | |       |  | |            |  | |      |  |    |          |  |                 |   |      |  | || |   |   | |     |  |  ..PS00007..                   | |       |  |   |  |        ********^             |  |||||||   |             |   |  |  |       |    || |           |  |            | | |||           |  |  |             | |                               ..PS00007..                      |  |             |  |             |  ||                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | |||              | |             | |       |  | |            |  | |      |  ^*****          |  |                 |   |      |  | || |   |   | |     |  |  ..PS00008..                   | |       |  |   |  |             | |              |  |||||||   |             |   |  |  |       ^*****| |           |  |            | | |||           |  |  |             | |                               ..PS00008..                      |  |             |  |             |  ||                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |||              | |             | |       |  | |            |  | |      |  |               |  |                 |   |      |  | || |   |   | |     |  |  ..alphabetamotif..                   | |       |  |   |  |             | |              |  |||||||   |             |   |  |  |             | |           |  |            | | |||           |  |  |             | |                               ..alphabetamotif..                      |  |             |  |             *****                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | |||              | |             | |       |  | |            |  | |      |  |               |  |                 |   |      |  ***| |   |   | |     |  |  ..asxturn..                   | |       |  |   |  |             | |              |  |||||||   |             |   |  |  |             | |           |  |            | | |||           |  |  |             | |                               ..asxturn..                      |  |             |  |             |  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****|              | |             | |       |  | |            **** |      |  |               ****                 |   |      |  |  | |   |   | |     |  |  ..betaturn..                   | |       |  |   |  |             | |              ********||   |             |   |  |  |             | |           |  |            | ****|           |  |  |             | |                               ..betaturn..                      |  |             |  |             ****                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            | |              | |             | |       |  ***               | |      |  |                                    |   |      |  |  | |   |   | |     |  |  ..gammaturn..                   | |       |  |   |  |             | |              |  | || ||   |             |   |  |  |             | |           |  |            |   | |           |  |  |             | |                               ..gammaturn..                      |  |             |  |                                   
search RasMol script viewer Motif-ligand binding stats  nest ..            ***              | |             ***       |  |                 ***      |  |                                    |   |      |  |  | |   |   ***     |  |  ..nest..                   ***       |  |   |  |             ***              |  | |***|   |             |   |  |  |             ***           |  |            |   ***           |  |  |             ***                               ..nest..                      |  |             |  |                                   
search RasMol script viewer Motif-ligand binding stats  niche ..                             ***                       ****                          ****                                    |   |      ******* |   |           ****  ..niche..                             ****   ****                              ******   |   |             |   |  ****                           ****            |   |             *******                                               ..niche..                      ****             ****                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                             *****              *****                 ..ststaple..                                                                               *****             *****                                                 *****                                                                   ..ststaple..                                                                              

   New search    4rg7:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors