triangle PDBeMotif: 4ra2  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.3.16
Classification metal binding protein    | release date: Tue, Sep 9, 2014
Title pp2ca
Authors C.PAN, F.G.M, H.A.WANG, H.D.LIU, J.P.SUN, J.Y.TANG, P.XIAO, W.B.WANG, Y.F.XU
Method X-RAY DIFFRACTION (resolution: 1.94Å)
PDBe Citation   
Small molecules:    search MN MN binding statistics MN   search PO4 PO4 binding statistics PO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITN
NQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFT
QDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGI
WDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIK
KQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPY
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PHOSPHATASE 1A
member of: GENE3D:searchG3DSA_1.10.10.430/searchG3DSA_3.60.40.10PANTHER:searchPTHR13832/searchPTHR13832_SF262PFAM:searchPF00481/searchPF07830PROSITE PATTERNS:searchPS01032, PROSITE PROFILES:searchPS51746, SMART:searchSM00331/searchSM00332SUPERFAMILY:searchSSF81601/searchSSF81606UniProt:searchP35813
JMol viewer RasMol script viewer  PO4 403A  ..                               *                                                                                                                                                                                                                                                                                                ..PO4 ..                                           
JMol viewer RasMol script viewer  MN 402A  ..                               |                                                                                                                                                                                                                                                                                                ..MN ..                                           
JMol viewer RasMol script viewer  MN 401A  ..                               |                                                                                                                                                                                                                                                        *                                       ..MN ..                                           
sec str:  .............eeeeeee..eeeeeeee........eeeeeeeee...eeeeeeeeeeeee..hhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhh......ee.eeeeee...eeeeeee...eeeeee..eeeee.......hhhhhhhhhhh...ee..ee.........ee.hhhh.....hhhhh......eeeeee.....eeeeeeehhhhhh..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....eeeeeee.......hhhhhhhhhhhhhhhhhhhhhhh.... .....hhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh..
sequence :  ..GAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIK... ..GVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPY
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       ... ..326       336       346       356          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |     | |  |        | |  | |      |  |||| | |    |  ||    |            | |        |   |  |    |          | || | | ||        |  |      | |                 |  |      || |||      |^***   |   ||||| |  | |  |  | |        || ||          |  |          |||||| | |         || ||| |^***    |  |   |   ||       |      |  |..PS00001..   |  ||  |   | |  | ||| | |||      |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |     | |  |        | |  | |      |  |||| | |    |  ||    |            | |        |   |  |    |          ^**| | | ||        |  |      | |                 |  |      || |||      | |||   |   ||||| |  | |  |  | |        || ||          |  |          |||||| | |         || ||| | |      |  |   |   ||       |      |  |..PS00005..   |  ||  |   | |  | ||| | ^**      |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |     | |  |        | |  | |      |  ^*** | |    |  ||    |            | |        |   |  |    |             | | | ||        |  |      | |                 |  |      || |||      | |||   |   ||||| |  | |  |  | |        ^***|          |  |          ^***|| | |         || ||| | |      |  |   |   ||       |      |  |..PS00006..   |  ||  |   | |  | ||| | |||      |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..       | |     | |  |        | |  | |      |   ||| | |    |  ||    |            | |        |   |  |    |             | | | ||        |  |      | |                 |  |      || |||      | |||   *******^| |  | |  |  | |        ||  |          |  |           || || | |         || ||| | |      |  |   |   |********^      |  |..PS00007..   |  ||  |   | |  | ||| | ||*******^      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |     ^*****        | |  | |      ^*****| | |    |  |^*****            | |        |   |  ^*****             | ^*****        |  |      | |                 |  |      || |||      | |||       ||||| |  | |  |  | |        ||  |          |  |           || || | |         || |^*****      |  |   |   |               |  |..PS00008..   |  ||  |   | |  | |^*****|              
search RasMol script viewer Motif-ligand binding stats  PPM_1 ..       | |       |  |        | |  | |          ||| | *****^***                  | |        |   |                     | | | |         |  |      | |                 |  |      || |||      | |||       ||||| |  | |  |  | |        ||  |          |  |           || || | |         || ||| |        |  |   |   |               |  |..PS01032..   |  ||  |   | |  | | | |  |              
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |       |  |        | |  | |          ||| |                            | |        |   |                     | | | |         |  |      | |                 |  |      || |||      | |||       ||||| |  | |  |  | |        ||  |          |  |           || || | |         || ||| |        |  |   |   |               |  |..asxmotif..   *****  |   | |  | | | |  |              
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |       |  |        | |  | |          ||| |                            ***        |   |                     | | ***         |  |      | |                 |  |      || |||      | |||       ||||| |  | |  |  | |        ||  |          |  |           || || ***         || ||| |        |  |   |   |               |  |..asxturn..      |   |   | |  | | | |  |              
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       | |       |  |        | |  | |          ||| |                                       |   |                     | | | |         |  |      | |                 |  |      || |||      *****       ||||| |  | |  |  | |        ||  |          |  |           || || |           || ||| |        |  |   |   |               |  |..betabulgeloop..      |   |   | |  | | | |  |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |       ****        | |  | |          |****                                       |   |                     | | | |         |  |      | |                 ****      |****|      ****|       ***** |  | |  |  | |        ||  |          |  |           ****| |           |****| |        |  |   |   |               ****..betaturn..      |   |   | |  | | | ****              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |                   | |  | |          ||| |                                       |   |                     | | | |         |  |      | |                 |  |      |  | |        | |       | | | |  | |  |  | |        ||  |          |  |            |  | |           |  | | |        |  |   |   |                   ..gammaturn..      |   |   | |  | ***                   
search RasMol script viewer Motif-ligand binding stats  nest ..       | |                   | |  | |          *** |                                       |   |                     *** | |         |  |      | |                 |  |      |  ***        ***       *** | |  | |  |  | |        ||  |          |  |            |  | |           |  *** |        |  |   |   |                   ..nest..      |   |   ***  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..       ***                   ***  ***           ****                                       |   |                       *****         ****      ***                 ****      |    |                      ****** ****  ***        |****          ****            ******           |    ***        ****   |   |                   ..niche..      |   |     ****                       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                           |   |                                                                             ******                                   | |        |   |                             | |           ******                 |   |                   ..schellmannloop..      |   |                                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                           *****                                                                                                                      | |        *****                             | |                                  *****                   ..stmotif..      |   |                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                      | |                                          | |                                                          ..ststaple..      *****                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                      ***                                          ***                                                          ..stturn..                                           

   New search    4ra2:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors