triangle PDBeMotif: 4qqn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transferase    | release date: Fri, Jun 27, 2014
Title protein arginine methyltransferase 3 in complex with compoun mtv044246
Authors A.DONG, A.M.EDWARDS, C.BOUNTRA, C.H.ARROWSMITH, CONSORTIUM (SGC), D.SMIL, E.DOBROVETSKY, H.HE, H.ZHANG, K.ZHAO, K.ZHAO, M.DAI, M.LANDON, M.SCHAPIRA, M.VEDADI, P.J.BROWN, STRUCTURAL GE, W.TEMPEL, X., Y.LIN, Z.CHEN, Z.YU
Method X-RAY DIFFRACTION (resolution: 2.08Å)
PDBe Citation   
Small molecules:    search UNX UNX binding statistics UNX   search GOL GOL binding statistics GOL   search 3BQ 3BQ binding statistics 3BQ   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSSHHHHHHSSGLVPRGSDLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSM
FAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKY
LAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISD
LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKD
PRSLTVTLTLNNSTQTYGLQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PRMT3 PROTEIN
member of: GENE3D:searchG3DSA_2.70.160.11/searchG3DSA_3.40.50.150PANTHER:searchPTHR11006/searchPTHR11006_SF45PFAM:searchPF06325PROSITE PROFILES:searchPS51678, SUPERFAMILY:searchSSF53335UniProt:searchO60678
JMol viewer RasMol script viewer  UNX 615A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                 
JMol viewer RasMol script viewer  UNX 614A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                 
JMol viewer RasMol script viewer  UNX 613A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                 
JMol viewer RasMol script viewer  UNX 612A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                 
JMol viewer RasMol script viewer  UNX 611A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                 
JMol viewer RasMol script viewer  UNX 610A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                 
JMol viewer RasMol script viewer  UNX 609A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                 
JMol viewer RasMol script viewer  UNX 608A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                 
JMol viewer RasMol script viewer  UNX 607A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                 
JMol viewer RasMol script viewer  UNX 606A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                 
JMol viewer RasMol script viewer  UNX 605A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                 
JMol viewer RasMol script viewer  UNX 604A  ..                                                                                                                                                                                                                                                                                          ..UNX ..                 
JMol viewer RasMol script viewer  CL 603A  ..                                                                                                                                                                                             *                                     *                   *                                  ..CL ..                 
JMol viewer RasMol script viewer  GOL 602A  ..                     *  *                       **                                                                                                                                           |                                     |                   |                                  ..GOL ..                 
JMol viewer RasMol script viewer  3BQ 601A  .. *  *                |  |                       ||                                                                                               *  **  *                       * * *        |                                **   |                   |           *                      ..3BQ ..                 
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee....hhhhhhhhhh...eeeeee..hhhhhhhhhhhhh.....eeeee............eeeee............hhhhhhhhhhhheeeeeeee..eeeeeeeee.hhhhhhhhhhhhhh.....hhhhhhhhh...eee..hhhhh....eeeeeee....hhhhhheeeeeeee....eeeeeeeeeeeeee.......eeee...........eeeeeeeeeeee....eeeeeeeee..... ....eeeeee..eeeeee.
sequence :  ..YGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKN... ..SLTVTLTLNNSTQTYGL
seq num:  ..244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514         ... ..531       541    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      |  | |   | ||     || || |     |||||||   || |||    | | |||        | |||| ||     || ||            | |  |||| | ||      |  ||  |    ||                   |  ||  |        |  |       |  |      ||  ||| || || |     | |                  |  |      | |  | || |||         | |  |           ..PS00001..        ^***     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  | |   ^**|     || || |     |||||||   || |||    | | |||        | |||| ||     || ||            | |  |||| | ||      |  ||  |    ||                   |  ||  |        |  |       |  |      ||  ||| || || |     ^**                  |  |      | |  ^**| |||         ^**  |           ..PS00005..                 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  | |   ^***     || || |     |||||||   || |||    | | |||        | |||| ||     || ||            | |  |||| ^***      |  ||  |    ||                   |  ||  |        |  |       |  |      ||  ||| |^*** |                          |  |      | |  |  | |||           |  |           ..PS00006..                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  | |   |        || || |     ^*****|   || |||    ^*****|        | |||| ||     || ||            | |  |||| | |       |  ||  |    ||                   |  ||  |        |  |       |  |      ||  ||| |  |  |                          |  |      | |  |  | |||           |  |           ..PS00008..                 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  | |   |        ***** |     |||||||   || |||      | | |        | ||*****     *****            | |  |||| | |       |  ||  |    ||                   |  ||  |        |  |       |  |      ||  ||| |  |  |                          |  |      | |  |  | |||           |  |           ..alphabetamotif..                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  | |   |        || || |     |||||||   || |||      *** |        | |||| ||     || ||            | |  |||| | |       |  ||  |    ||                   |  ||  |        |  |       |  |      ||  *** |  |  |                          |  |      | |  |  | |||           |  |           ..asxturn..                 
search RasMol script viewer Motif-ligand binding stats  betabulge ..      |  | |   |        || || |     |||||||   || |||      | | |        | |||| ||     || ||            | |  |||| | |       |  ||  |    **                   |  ||  |        |  |       |  |      **  ||  |  |  |                          |  |      | |  |  | |||           |  |           ..betabulge..                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  | |   |        *******     |****||   |****|      | | |        ********|     ****|            | |  |||| | |       |  |****                         |  |****        |  |       |  |          ||  |  |  |                          ****      | |  |  ****|           ****           ..betaturn..                 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  | |   |         | || |     | |||||   |  | |      | | |          ||||  |      |  |            | |  ***| | |       |  |                             |  |            |  |       |  |          ||  |  |  |                          |  |      | |  |  | | |           |  |           ..gammaturn..                 
search RasMol script viewer Motif-ligand binding stats  nest ..      |  | |   |         | || |     *******   |  ***      | | |          ****  |      |  |            | |   ||| | |       |  |                             |  |            |  |       |  |          ||  |  |  |                          |  |      | |  |  | | |           |  |           ..nest..                 
search RasMol script viewer Motif-ligand binding stats  niche ..      **** |   |         ******               |    |      *** |             ****      ****            ***   ***** |       ****                             ****            ****       ****          |****  ****                          ****      ******  | | |           ****           ..niche..                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..           |   |                              ******        | |                                                 | |                                                                                 |   |                                          | |     | | |                          ..schellmannloop..                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..           |   |                                            | |                                                 | |                                                                                 |   |                                          | |     *****                          ..stmotif..                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****                                            | |                                                 | |                                                                                 *****                                          | |     | |                            ..ststaple..                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                            ***                                                 ***                                                                                                                                ***     ***                            ..stturn..                 

   New search    4qqn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors