triangle PDBeMotif: 4q96  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Tue, Apr 29, 2014
Title cid of human rprd1b in complex with an unmodified ctd peptid
Authors A.M.EDWARDS, C.BOUNTRA, C.H.ARROWSMITH, C.XU, CONSORTIUM (SGC), J.F.GREENBLATT, J.MIN, M.EL BAKKOURI, P.LOPPNAU, STRUCTURAL, W.TEMPEL, X.GUO, Z.NI
Method X-RAY DIFFRACTION (resolution: 1.85Å)
PDBe Citation   
Small molecules:    search UNX UNX binding statistics UNX   search BTN BTN binding statistics BTN   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,D,E sequence:
GSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTRE
FESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSP
Chains C,F sequence:
SPSYSPTSPSYSPTSPSYSX
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : REGULATION OF NUCLEAR PRE-MRNA DOMAIN-CONTAINING1B;
member of: GENE3D:searchG3DSA_1.25.40.90PANTHER:searchPTHR12460PFAM:searchPF04818PROSITE PROFILES:searchPS51391, SMART:searchSM00582SUPERFAMILY:searchSSF48464UniProt:searchQ9NQG5
JMol viewer RasMol script viewer  SO4 209D  ..*                            *  *                                                                                               
JMol viewer RasMol script viewer  SO4 208D  ..|            * *             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 207D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 206D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 205D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 204D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 203D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 202D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 201D  ..|            | |             |  |                                                                                               
sec str:  ...hhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh..
sequence :  ..FSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMED
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  ||  |**^* || | |   |                      |  | | **^*           | |||      |  ||                            ||||      |   |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||  |  |  || | |   |                      |  | ^**              ^**||      |  ||                            ||||      |   |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***^***  |  || | |   |                      |  |                  |  ||      |  ||                            ||||      |   ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***      |  || | |   |                      |  |                  |  ||      |  ||                            ||||      |   |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  || | |   |                      |  |                  *****      *****                            ||||      |   |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  || | |   |                      |  |                  ****       ****                             ||||      |   |   
search RasMol script viewer Motif-ligand binding stats  nest ..         |  || | |   |                      |  |                                                              ****      |   |   
search RasMol script viewer Motif-ligand binding stats  niche ..         ******* |   |                      ****                                                                        |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..             | | *****                                                                                                  *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..             ***                                                                                                                

chain E : REGULATION OF NUCLEAR PRE-MRNA DOMAIN-CONTAINING1B;
member of: GENE3D:searchG3DSA_1.25.40.90PANTHER:searchPTHR12460PFAM:searchPF04818PROSITE PROFILES:searchPS51391, SMART:searchSM00582SUPERFAMILY:searchSSF48464UniProt:searchQ9NQG5
JMol viewer RasMol script viewer  SO4 207E  ..                             * *                                      *                                                         
JMol viewer RasMol script viewer  UNX 206E  ..                             | |                                      |                                                         
JMol viewer RasMol script viewer  UNX 205E  ..                             | |                                      |                                                         
JMol viewer RasMol script viewer  UNX 204E  ..                             | |                                      |                                                         
JMol viewer RasMol script viewer  UNX 203E  ..                             | |                                      |                                                         
JMol viewer RasMol script viewer  UNX 202E  ..                             | |                                      |                                                         
JMol viewer RasMol script viewer  UNX 201E  ..                             | |                                      |                                                         
sec str:  ....hhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh..
sequence :  ..SFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSME
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  ||  |**^* |  | | | |       |  |           |  | | **^*           | |||      |  ||                         || ||||          |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  ||  |  |  |  | | | |       |  |           |  | ^**              ^**||      |  ||                         || ||||          |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***^***  |  |  | | | |       |  |           |  |                  |  ||      |  ||                         || ||||          ^**
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****      |  |  | | | |       |  |           |  |                  |  ||      |  ||                         || ||||             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |  | | | |       |  |           |  |                  *****      *****                         || ||||             
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |  | | | |       ****           |  |                  ****       ****                          |****||             
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |  | | | |                      |  |                                                           |  ****             
search RasMol script viewer Motif-ligand binding stats  niche ..          ****  | | | |                      ****                                                           |    |              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                | | | |                                                                                     ******              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                ***** |                                                                                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  *****                                                                                                         

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : REGULATION OF NUCLEAR PRE-MRNA DOMAIN-CONTAINING1B;
member of: GENE3D:searchG3DSA_1.25.40.90PANTHER:searchPTHR12460PFAM:searchPF04818PROSITE PROFILES:searchPS51391, SMART:searchSM00582SUPERFAMILY:searchSSF48464UniProt:searchQ9NQG5
JMol viewer RasMol script viewer  UNX 208A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 207A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 206A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 205A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 204A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 203A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 202A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 201A  ..                                                                                                                                 
sec str:  ....hhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh..
sequence :  ..SFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMED
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| ||| ||**^* || | |   |       |  |           |  | | **^*           | |||      |  ||                            ||||          |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ||| ||  |  || | |   |       |  |           |  | ^**              ^**||      |  ||                            ||||          |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***^***  |  || | |   |       |  |           |  |                  |  ||      |  ||                            ||||          ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****  |   |  || | |   |       |  |           |  |                  |  ||      |  ||                            ||||              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |   |   |  || | |   |       |  |           |  |                  *****      *****                            ||||              
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |   |   |  || | |   |       ****           |  |                  ****       ****                             ||||              
search RasMol script viewer Motif-ligand binding stats  nest ..  |   |   |  || | |   |                      |  |                                                              ****              
search RasMol script viewer Motif-ligand binding stats  niche ..  |   |   ******* |   |                      ****                                                                                
search RasMol script viewer Motif-ligand binding stats  stmotif ..  *****       | | |   |                                                                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..              | | *****                                                                                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..              ***                                                                                                                

chain B : REGULATION OF NUCLEAR PRE-MRNA DOMAIN-CONTAINING1B;
member of: GENE3D:searchG3DSA_1.25.40.90PANTHER:searchPTHR12460PFAM:searchPF04818PROSITE PROFILES:searchPS51391, SMART:searchSM00582SUPERFAMILY:searchSSF48464UniProt:searchQ9NQG5
JMol viewer RasMol script viewer  SO4 202B  ..                                                                                                  *   *                         
JMol viewer RasMol script viewer  UNX 201B  ..                                                                                                  |   |                         
JMol viewer RasMol script viewer  UNX 208A  ..                                                                                                  |   |                         
sec str:  ...hhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh..
sequence :  ..FSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMED
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. ||| ||**^* |  | | | |                      |  ||| **^*           | |||      |  ||                            ||||         || ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ||| ||  || |  | | | |                      |  ||^**              ^**||      |  ||                            ||||         || ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***^***  || |  | | | |                      |  ||  |              |  ||      |  ||                            ||||         |^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***  ||  || |  | | | |                      |  ||  |              |  ||      |  ||                            ||||         |  ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |   ||  || |  | | | |                      |  ||  |              *****      *****                            ||||         *****
search RasMol script viewer Motif-ligand binding stats  betaturn .. |   ||  || |  | | | |                      |  |****              ****       ****                             ||||         **** 
search RasMol script viewer Motif-ligand binding stats  nest .. |   ||  || |  | | | |                      |  |                                                              ****              
search RasMol script viewer Motif-ligand binding stats  niche .. |   ||  ****  | | | |                      ****                                                                                
search RasMol script viewer Motif-ligand binding stats  stmotif .. *****|   |    ***** |                                                                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..      *****      *****                                                                                                          

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : REGULATION OF NUCLEAR PRE-MRNA DOMAIN-CONTAINING1B;
member of: GENE3D:searchG3DSA_1.25.40.90PANTHER:searchPTHR12460PFAM:searchPF04818PROSITE PROFILES:searchPS51391, SMART:searchSM00582SUPERFAMILY:searchSSF48464UniProt:searchQ9NQG5
JMol viewer RasMol script viewer  SO4 208D  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 208A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 207A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 206A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 205A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 204A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 203A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 202A  ..                                                                                                                                 
JMol viewer RasMol script viewer  UNX 201A  ..                                                                                                                                 
sec str:  ....hhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh..
sequence :  ..SFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMED
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| ||| ||**^* || | |   |       |  |           |  | | **^*           | |||      |  ||                            ||||          |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ||| ||  |  || | |   |       |  |           |  | ^**              ^**||      |  ||                            ||||          |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***^***  |  || | |   |       |  |           |  |                  |  ||      |  ||                            ||||          ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****  |   |  || | |   |       |  |           |  |                  |  ||      |  ||                            ||||              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |   |   |  || | |   |       |  |           |  |                  *****      *****                            ||||              
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |   |   |  || | |   |       ****           |  |                  ****       ****                             ||||              
search RasMol script viewer Motif-ligand binding stats  nest ..  |   |   |  || | |   |                      |  |                                                              ****              
search RasMol script viewer Motif-ligand binding stats  niche ..  |   |   ******* |   |                      ****                                                                                
search RasMol script viewer Motif-ligand binding stats  stmotif ..  *****       | | |   |                                                                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..              | | *****                                                                                                          
search RasMol script viewer Motif-ligand binding stats  stturn ..              ***                                                                                                                

chain B : REGULATION OF NUCLEAR PRE-MRNA DOMAIN-CONTAINING1B;
member of: GENE3D:searchG3DSA_1.25.40.90PANTHER:searchPTHR12460PFAM:searchPF04818PROSITE PROFILES:searchPS51391, SMART:searchSM00582SUPERFAMILY:searchSSF48464UniProt:searchQ9NQG5
JMol viewer RasMol script viewer  UNX 1701F  ..                                                                                                                                
JMol viewer RasMol script viewer  UNX 204D  ..                                                                                                                                
JMol viewer RasMol script viewer  SO4 202B  ..                                                                                                  *   *                         
JMol viewer RasMol script viewer  UNX 201B  ..                                                                                                  |   |                         
JMol viewer RasMol script viewer  UNX 208A  ..                                                                                                  |   |                         
JMol viewer RasMol script viewer  BTN 1611F  ..                                                                                                  |   |   *                     
JMol viewer RasMol script viewer  BTN 1611C  ..                 *                                                                                |   |   |                     
sec str:  ...hhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh..
sequence :  ..FSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMED
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. ||| ||**^* |  | | | |                      |  ||| **^*           | |||      |  ||                            ||||         || ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ||| ||  || |  | | | |                      |  ||^**              ^**||      |  ||                            ||||         || ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***^***  || |  | | | |                      |  ||  |              |  ||      |  ||                            ||||         |^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***  ||  || |  | | | |                      |  ||  |              |  ||      |  ||                            ||||         |  ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |   ||  || |  | | | |                      |  ||  |              *****      *****                            ||||         *****
search RasMol script viewer Motif-ligand binding stats  betaturn .. |   ||  || |  | | | |                      |  |****              ****       ****                             ||||         **** 
search RasMol script viewer Motif-ligand binding stats  nest .. |   ||  || |  | | | |                      |  |                                                              ****              
search RasMol script viewer Motif-ligand binding stats  niche .. |   ||  ****  | | | |                      ****                                                                                
search RasMol script viewer Motif-ligand binding stats  stmotif .. *****|   |    ***** |                                                                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..      *****      *****                                                                                                          

chain C : RPB1-CTD
JMol viewer RasMol script viewer  UNX 201B  ..                    
JMol viewer RasMol script viewer  UNX 205A  ..                    
JMol viewer RasMol script viewer  BTN 1611F  ..           ***      
JMol viewer RasMol script viewer  BTN 1611C  ..*          |||      
sec str:  ......eee.............
sequence :  ..SPSYSPTSPSYSPTSPSYSX
seq num:  ..1612      1622      
search RasMol script viewer Motif-ligand binding stats  RNA_POL_II_REPEAT ..   **************   
search RasMol script viewer Motif-ligand binding stats  niche ..            ****    

chain D : REGULATION OF NUCLEAR PRE-MRNA DOMAIN-CONTAINING1B;
member of: GENE3D:searchG3DSA_1.25.40.90PANTHER:searchPTHR12460PFAM:searchPF04818PROSITE PROFILES:searchPS51391, SMART:searchSM00582SUPERFAMILY:searchSSF48464UniProt:searchQ9NQG5
JMol viewer RasMol script viewer  SO4 209D  ..*                            *  *                                                                                               
JMol viewer RasMol script viewer  SO4 208D  ..|            * *             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 207D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 206D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 205D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 204D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 203D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 202D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 201D  ..|            | |             |  |                                                                                               
JMol viewer RasMol script viewer  UNX 205A  ..|            | |             |  |                                                                                               
sec str:  ...hhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh..
sequence :  ..FSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMED
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  ||  |**^* || | |   |                      |  | | **^*           | |||      |  ||                            ||||      |   |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||  |  |  || | |   |                      |  | ^**              ^**||      |  ||                            ||||      |   |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***^***  |  || | |   |                      |  |                  |  ||      |  ||                            ||||      |   ^***
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***      |  || | |   |                      |  |                  |  ||      |  ||                            ||||      |   |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  || | |   |                      |  |                  *****      *****                            ||||      |   |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  || | |   |                      |  |                  ****       ****                             ||||      |   |   
search RasMol script viewer Motif-ligand binding stats  nest ..         |  || | |   |                      |  |                                                              ****      |   |   
search RasMol script viewer Motif-ligand binding stats  niche ..         ******* |   |                      ****                                                                        |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..             | | *****                                                                                                  *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..             ***                                                                                                                

chain E : REGULATION OF NUCLEAR PRE-MRNA DOMAIN-CONTAINING1B;
member of: GENE3D:searchG3DSA_1.25.40.90PANTHER:searchPTHR12460PFAM:searchPF04818PROSITE PROFILES:searchPS51391, SMART:searchSM00582SUPERFAMILY:searchSSF48464UniProt:searchQ9NQG5
JMol viewer RasMol script viewer  SO4 207E  ..                             * *                                      *                                                         
JMol viewer RasMol script viewer  UNX 206E  ..                             | |                                      |                                                         
JMol viewer RasMol script viewer  UNX 205E  ..                             | |                                      |                                                         
JMol viewer RasMol script viewer  UNX 204E  ..                             | |                                      |                                                         
JMol viewer RasMol script viewer  UNX 203E  ..                             | |                                      |                                                         
JMol viewer RasMol script viewer  UNX 202E  ..                             | |                                      |                                                         
JMol viewer RasMol script viewer  UNX 201E  ..                             | |                                      |                                                         
JMol viewer RasMol script viewer  BTN 1611F  ..                  *          | |                                      |                                                         
JMol viewer RasMol script viewer  BTN 1611C  ..                  |          | |                                      |                                *   *                    
sec str:  ....hhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh..
sequence :  ..SFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSME
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  ||  |**^* |  | | | |       |  |           |  | | **^*           | |||      |  ||                         || ||||          |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  ||  |  |  |  | | | |       |  |           |  | ^**              ^**||      |  ||                         || ||||          |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***^***  |  |  | | | |       |  |           |  |                  |  ||      |  ||                         || ||||          ^**
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****      |  |  | | | |       |  |           |  |                  |  ||      |  ||                         || ||||             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  |  | | | |       |  |           |  |                  *****      *****                         || ||||             
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |  | | | |       ****           |  |                  ****       ****                          |****||             
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |  | | | |                      |  |                                                           |  ****             
search RasMol script viewer Motif-ligand binding stats  niche ..          ****  | | | |                      ****                                                           |    |              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                | | | |                                                                                     ******              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                ***** |                                                                                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  *****                                                                                                         

chain F : RPB1-CTD
JMol viewer RasMol script viewer  UNX 1701F  ..                    
JMol viewer RasMol script viewer  SO4 208D  ..                    
JMol viewer RasMol script viewer  UNX 204D  ..                    
JMol viewer RasMol script viewer  SO4 202B  ..                    
JMol viewer RasMol script viewer  BTN 1611F  ..*                   
JMol viewer RasMol script viewer  BTN 1611C  ..|          ***      
sec str:  ......eee.............
sequence :  ..SPSYSPTSPSYSPTSPSYSX
seq num:  ..1612      1622      
search RasMol script viewer Motif-ligand binding stats  RNA_POL_II_REPEAT ..   **************   
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****|    
search RasMol script viewer Motif-ligand binding stats  niche ..            ****    

   New search    4q96:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors