triangle PDBeMotif: 4pei  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification hydrolase/rna    | release date: Wed, Apr 23, 2014
Title dbr1 in complex with synthetic branched rna analog
Authors A.B.TAYLOR, A.KATOLIK, D.J.COMBS, E.J.MONTEMAYOR, J.P.SCHUERMANN, M.J.DAMHA, N.E.CLARK, P.J, R.JOHNSSON, S.P.HOLLOWAY, S.W.STEVENS
Method X-RAY DIFFRACTION (resolution: 1.95Å)
PDBe Citation   
Small molecules:    search NI NI binding statistics NI   search PG4 PG4 binding statistics PG4   search GOL GOL binding statistics GOL   search SO4 SO4 binding statistics SO4   search G46 G46 binding statistics G46
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E sequence:
GAMATEQIQHIAIVGSVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKE
KAPYLTLFIGGNHESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTR
NYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAE
EGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELW
EKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNIN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RNA LARIAT DEBRANCHING ENZYME, PUTATIVE
member of: GENE3D:searchG3DSA_3.60.21.10PANTHER:searchPTHR12849PFAM:searchPF00149SUPERFAMILY:searchSSF56300UniProt:searchC4M1P9
JMol viewer RasMol script viewer  GOL 404A  ..                                                                                                                                *                                               *                           **                   *                                                                                                                           
JMol viewer RasMol script viewer  GOL 403A  ..                                                              *** **                                                            |                                               |                           ||                   |                                                                                                                           
JMol viewer RasMol script viewer  SO4 402A  ..                                             *                ||| ||                      *   *                                 |                                               |                           ||                   |                                                                                                                           
JMol viewer RasMol script viewer  NI 401A  ..                                        *    |                ||| ||                 *    |   |                                 |                                              *|                           ||                   *                                                                                                                           
JMol viewer RasMol script viewer  G46 510Q  ..           *                            *    |                ||| ||                 **   |   |                                 |                                              ||                   **  *   *|                   ***                                                                                                                         
sec str:  ...eeeeeee.....hhhhhhhhhhhhhhhhh..eeeeee........hhhhhhhh..hhhhh...hhhhhhh........eee......hhhhhhhh...eeee..eee...eeeeee..eeeeee....hhhhh...ee...hhhhhhh.....hhhhhhhh.........eeee.....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh..eeee......eeeee..eeeee.....hhh.eeeeeee.......eehhhhhhhhhhhhhhhh...ee.....hhhhhhhh.hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh.
sequence :  ..QIQHIAIVGSVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKEKAPYLTLFIGGNHESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELWEKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNI
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        | | ||        |  |  | ||        |||| | | || ||  || ||       | ||||          |    |     |  |   || |   |    | |  |      |  ||||| | |    | ||| |  |        | ^*** |  |         ||| |     |  ||  |  || || |   |    | |        | |      | |      |  ||  ||  |   |  |  |||   | |   || |||||    | |||  |||| |                |||   | |      | ||      |  | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | | ||        |  |  ^**|        |||^** | || ||  || ||       | ||||          |    |     |  |   || |   |    | |  |      |  ||||| | |    | ||| |  |        |  ||  |  |         ||| |     |  ||  |  || || |   |    ^**        | |      | |      |  ||  ||  |   |  |  |||   | |   || ||^**    | |||  |||^**                |||   | |      ^**|      |  | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | | ||        ^***  ^***        |||| | | || ||  || ||       | ||||          |    |     |  |   || |   |    | |  |      |  |^*** | |    ^***| |  |        |  ||  ^***         ||| |     |  ||  |  || || |   |               | |      | |      |  ||  |^***   |  ^***||   | |   || || |     | ||^***||  |                |||   | |         |      |  | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        | | ||              | |         |||| *******^|  || |********^ ||||          |    |     |  |   || |   |    | |  |      |  ********^    | ||| |  |        |  ||  |            ||| |     |  ||  |  || || |   |               | |      | |      |  ||  |       *******^|   | |   || || |     | |||   ||  |                |||   | |         *******^  | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ^*****              | |         ||||   | || ||  || ||         ||||          ^*****     |  ^***** |   ^***** |  |      ^*****|  |      | ||| |  |        |  ||  |            ||| |     |  ||  |  |^*****   |               | |      | |      |  ||  |               |   | |   || || |     | |||   ||  |                |||   | |                   | |
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..          | |               | |         ||||   | || ||  || ||         ||||                     |  |   |  |          |  |            |  |      | ||| |  |        |  ||  |            ||| |     |  ||  |  || || |   |               | |      | |      |  ||  |               |   | |   || || |     | |||   |**********************|   | |                   | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |               | |         ||||   | || ||  || ||         ||||                     |  |   |  |          |  |            |  |      | ||| |  |        |  ||  |            ||| |     *****  |  || || |   |               | |      | |      |  ||  |               |   | |   || || |     | |||   ||  |                | |   | |                   | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          | |               | |         ||||   | || ||  || ||         ||||                     |  |   |  |          |  |            |  |      | ||| |  |        |  ||  |            ||| |     |  ||  |  || || |   |               | |      | |      |  ||  |               ***** |   || || |     | |||   ||  |                | |   | |                   | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | |               | |         ||||   | || ||  || ||         ||||                     |  |   |  |          |  |            |  |      | ||| |  |        |  ||  |            ||| |     |  ||  |  || || |   |               | |      | |      |  ||  |                     |   || || |     ***||   ||  |                | |   | |                   | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |               | |         ||||   ******|  *****         ||||                     ****   ****          ****            ****      *******  |        ****|  |            |****     ********  ****| |   |               | |      | |      ****|  |                     |   |**** |     |  ||   ||  |                | |   | |                   | |
search RasMol script viewer Motif-ligand binding stats  nest ..          ***               ***         ****      |  |                ****                            |  |                          |  |      | | | |  |            |  |            ***                  |  | |   |               ***      | |      |  ||  |                     |   |  |  |     |  ||   ||  |                | |   | |                   ***
search RasMol script viewer Motif-ligand binding stats  niche ..                            | |                   ****                                                ****                          ****      | | | ****            ****                                 **** |   |                        ***      ********                     |   |  ****     ****|   |****                ***   ***                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                            | |                                                                                                               *****                                                           *****                                                              |   |               *****                                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                            | |                                                                                                               | |                                                                                                                                *****                                                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                            ***                                                                                                               ***                                                                                                                                                                                                            

chain V : RNA (5'-R(*UP*AP*AP*CP*A)-3')
JMol viewer RasMol script viewer  GOL 404A  ..   
JMol viewer RasMol script viewer  G46 510Q  ..*  
sec str:  .....
sequence :  ..ACA
seq num:  ..501

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : RNA LARIAT DEBRANCHING ENZYME, PUTATIVE
member of: GENE3D:searchG3DSA_3.60.21.10PANTHER:searchPTHR12849PFAM:searchPF00149SUPERFAMILY:searchSSF56300UniProt:searchC4M1P9
JMol viewer RasMol script viewer  PG4 403B  ..                                                                                             *                                         ****      *   *                                                                                                                                                                                                       
JMol viewer RasMol script viewer  SO4 402B  ..                                             *                                            *  |*                                        ||||      |   |                                                                                                                                                                                                       
JMol viewer RasMol script viewer  NI 401B  ..                                        *    |                                       *    |  ||                                        ||||      |   |                         *                                                 *                                                                                                                           
JMol viewer RasMol script viewer  G46 510R  ..           *                            *    |                                       **   |  ||                                        ||||      |   |                         |                                                 ***                                                                                                                         
sec str:  ...eeeeeee.....hhhhhhhhhhhhhhhhh..eeeeee........hhhhhhhh..hhhhh...hhhhhhh........eee......hhhhhhhh...eeee..eee...eeeeee..eeeeee....hhhhh...ee...hhhhhhh......hhhhhhh.........eeee.....hhhhhhhhhhhhhhh.hhhhhhhhh.hhhhhhhhhhhh..eeee......eeeee..eeeee.....hhh.eeeeeee.......eehhhhhhhhhhhhhhh....ee.....hhhhhhhh.hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhh..
sequence :  ..QIQHIAIVGSVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKEKAPYLTLFIGGNHESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELWEKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNI
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        | | ||        |  |  | ||        |||| |   || ||  || ||       | ||||          |    |     |  |   || |   |    | |  |      |  ||||| | |    |  |  || |     |  ||^*** |  |       | ||| |                |  | |   ||   | |      | | |      | |      |  ||  ||  |   |  |  ||      |   || ||||| |  |  ||  |||| |                |||   | |  |   | ||      |  | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | | ||        |  |  ^**|        |||^**   || ||  || ||       | ||||          |    |     |  |   || |   |    | |  |      |  ||||| | |    |  |  || |     |  || ||  |  |       | ||| |                |  | |   ||   ^**      | | |      | |      |  ||  ||  |   |  |  ||      |   || ||^** |  |  ||  |||^**                |||   | |  |   ^**|      |  | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | | ||        ^***  ^***        |||| |   || ||  || ||       | ||||          |    |     |  |   || |   |    | |  |      |  |^*** | |    ^***  || |     |  || ||  ^***       | ||| |                |  | |   ||   |        | | |      | |      |  ||  |^***   |  ^***|      |   || || |  |  |  |^***||  |                |||   | |  |   |  |      |  | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        | | ||              | |         |||| *******^|  || |********^ ||||          |    |     |  |   || |   |    | |  |      |  ********^    |  |  || |     |  || ||  |          | ||| |                |  | |   ||   |        | | |      | |      |  ||  |       *******^      |   || || |  |  |  ||   ||  |                |||   | |  |   |  *******^  | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ^*****              | |         ||||     || ||  || ||         ||||          ^*****     |  ^***** |   ^***** |  |      ^*****|  |      |  |  || |     |  || ||  |          | ||| |                ^*****   ||   |        | | |      | |      |  ||  |                     |   || || |  |  |  ||   ||  |                |||   | |  |   |            | |
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..          | |               | |         ||||     || ||  || ||         ||||                     |  |   |  |          |  |            |  |      |  |  || |     |  || ||  |          | ||| |                |  | |   ||   |        | | |      | |      |  ||  |                     |   || || |  |  |  ||   |**********************|   | |  |   |            | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |               | |         ||||     || ||  || ||         ||||                     |  |   |  |          |  |            |  |      |  ***** |     |  || ||  |          | ||| |                |  | |   ||   |        | | |      | |      |  ||  |                     |   || || |  |  |  ||   ||  |                | |   | |  |   |            | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | |               | |         ||||     || ||  || ||         ||||                     |  |   |  |          |  |            |  |      |  |  |  |     |  || ||  |          | ||| |                |  | |   ||   |        | | |      | |      |  ||  |                     |   || || |  |  |  ||   ||  |                | |   ***  |   |            | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |               | |         ||||     ****|  *****         ||||                     ****   ****          ****            |  |      *******  |     |  ****|  |          *******                |  | |   ||   |        | | |      | |      ****|  |                     |   |**** |  |  |  ||   ||  |                | |   | |  |   |            | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |               | |         ||||      |  |                ||||                            |  |                          |  |            |  |     |   |  |  |            | |                  |  | |   ||   |        | ***      | |      |  ||  |                     |   |  |  |  |  |  ||   ||  |                | |   | |  |   |            | |
search RasMol script viewer Motif-ligand binding stats  nest ..          ***               ***         ****      |  |                ****                            |  |                          |  |            |  |     |   |  |  |            ***                  |  | |   ||   |        | |        | |      |  ||  |                     |   |  |  |  |  |  ||   ||  |                | |   | |  |   |            ***
search RasMol script viewer Motif-ligand binding stats  niche ..                            | |                   ****                                                ****                          ****            ****     |   |  ****                                 **** |   ||   |        ***        ***      ********                     |   |  *******  ****|   |****                ***   ***  |   |               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                            | |                                                                                                                              |   |                                            *****|   |                                                         |   |               *****                               |   |               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                            | |                                                                                                                              *****                                                 *****                                                         *****                                                   *****               
search RasMol script viewer Motif-ligand binding stats  stturn ..                            ***                                                                                                                                                                                                                                                                                                                              

chain W : RNA (5'-R(*UP*AP*AP*CP*A)-3')
JMol viewer RasMol script viewer  G46 510R  ..*  
sec str:  .....
sequence :  ..ACA
seq num:  ..501

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : RNA LARIAT DEBRANCHING ENZYME, PUTATIVE
member of: GENE3D:searchG3DSA_3.60.21.10PANTHER:searchPTHR12849PFAM:searchPF00149SUPERFAMILY:searchSSF56300UniProt:searchC4M1P9
JMol viewer RasMol script viewer  GOL 404C  ..                                                                                                                                                                                         ****                                                                                                                                                                
JMol viewer RasMol script viewer  GOL 403C  ..                                 *                                            *                                     **                                                                   ||||                                                                        **                                                                                      
JMol viewer RasMol script viewer  SO4 402C  ..                                 |           *                                |           *   *                     ||                       *                                           ||||                                                                        ||                                                                                      
JMol viewer RasMol script viewer  NI 401C  ..                                 |           |                                |      *    |   |                     ||                       |                                 *         ||||                                    *                                   ||                                                                                      
sec str:  ...eeeeeee.....hhhhhhhhhhhhhhhhh..eeeeee........hhhhhhhh..hhhhh...hhhhhhh........eee......hhhhhhhh...eeee..eee...eeeeee..eeeeee....hhhhh...ee...hhhhhhh......hhhhhhh.........eeee.....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh..eeee......eeeee..eeeee.........eeeeeee.......eehhhhhhhhhhhhhhhh...ee.....hhhhhhhh.hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh.
sequence :  ..QIQHIAIVGSVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKEKAPYLTLFIGGNHESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELWEKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNI
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        | | ||    |   | ||  | ||        |||| |   || ||      |    | |||||||          |    |        |   || |   |    | |  |      |  ||||| | |    |  |  |  |          ^*** |  |       | ||| |          |  | || || |   ||   | |      | | |      | |      |  ||  ||  |   |  |  |||   | | | || |||||    |  ||  |||| |                |||   | |      | ||      |  | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | | ||    |   | ||  ^**|        |||^**   || ||      |    | |||||||          |    |        |   || |   |    | |  |      |  ||||| | |    |  |  |  |          |  | |  |       | ||| |          |  | || || |   ||   ^**      | | |      | |      |  ||  ||  |   |  |  |||   | | | || ||^**    |  ||  |||^**                |||   | |      ^**|      |  | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | | ||    |   ^***  ^***        |||| |   || ||      |    | |||||||          |    |        |   || |   |    | |  |      |  |^*** | |    ^***  |  |          |  | ^***       | ||| |          |  | || || |   ||   |        | | |      | |      |  ||  |^***   |  ^***||   | | | || || |     |  |^***||  |                |||   | |         |      |  | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        | | ||    |   | |   | |         |||| *******^|      ********^|||||          |    |        |   || |   |    | |  |      |  ********^       |  |  |          |  |            | ||| |          |  | || || |   ||   |        | | |      | |      |  ||  |       *******^|   | | | || || |     |  ||   ||  |                |||   | |         *******^  | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ^*****    |   | |   | |         ||||     || ||           | |||||||          ^*****        ^***** |   ^***** |  |      ^*****|  |         |  |  |          |  |            | ||| |          |  | |^*****   ||   |        | | |      | |      |  ||  |               |   | | | || || |     |  ||   ||  |                |||   | |                   | |
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..          | |     |   | |   | |         ||||     || ||           | |||||||                            |  |          |  |            |  |         |  |  |          |  |            | ||| |          |  | || || |   ||   |        | | |      | |      |  ||  |               |   | | | || || |     |  ||   |**********************|   | |                   | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |     |   | |   | |         ||||     || ||           *****||||                            |  |          |  |            |  |         |  |  |          |  |            | ||| |          |  | || || |   ||   |        | | |      | |      |  ||  |               |   | | | || || |     |  ||   ||  |                | |   | |                   | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          | |     |   | |   | |         ||||     || ||           | || ||||                            |  |          |  |            |  |         |  |  |          |  |            | ||| |          |  | || || |   ||   |        | | |      | |      |  ||  |               ***** | | || || |     |  ||   ||  |                | |   | |                   | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | |     |   | |   | |         ||||     || ||           | || ||||                            |  |          |  |            |  |         |  |  |          |  |            | ||| |          |  | || || |   ||   |        | | |      | |      |  ||  |                     | | || || |     |  ||   ||  |                | |   ***                   | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |     |   | |   | |         ||||     ****|           *******||                            |  |          ****            ****         ****  |          ****            *******          **** ****| |   ||   |        | | |      | |      ****|  |                     | ******* |     ****|   ||  |                | |   | |                   | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |     |   | |   | |         ||||      |  |             |  ||||                            |  |                          |  |            |  |                            | |                  |  | |   ||   |        | ***      | |      |  ||  |                     |   |  |  |     |  ||   ||  |                | |   | |                   | |
search RasMol script viewer Motif-ligand binding stats  nest ..          ***     |   | |   ***         ****      |  |             |  ****                            |  |                          |  |            |  |                            ***                  |  | |   ||   |        | |        | |      |  ||  |                     |   |  |  |     |  ||   ||  |                | |   | |                   ***
search RasMol script viewer Motif-ligand binding stats  niche ..                  |   | |   | |                   ****             |    |                             ****                          ****            ****                                                 **** |   ||   |        ***        ***      ********                     |   |  ****     ****|   |****                ***   ***                      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                  |   | |   | |                                    ******                                                                                                                                     |   ||   |                                                         |   |               |   |                                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                  |   | |   | |                                                                                                                                                                               *****|   |                                                         |   |               *****                                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  ***** ***** |                                                                                                                                                                                    *****                                                         *****                                                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                            ***                                                                                                                                                                                                                                                                                                                              

chain X : RNA (5'-R(*UP*AP*AP*CP*A)-3')
JMol viewer RasMol script viewer  NI 401C  ..  *
JMol viewer RasMol script viewer  G46 510S  ..* |
sec str:  .....
sequence :  ..ACA
seq num:  ..501

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : RNA LARIAT DEBRANCHING ENZYME, PUTATIVE
member of: GENE3D:searchG3DSA_3.60.21.10PANTHER:searchPTHR12849PFAM:searchPF00149SUPERFAMILY:searchSSF56300UniProt:searchC4M1P9
JMol viewer RasMol script viewer  GOL 404D  ..                                                                  *   * *                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  GOL 403D  ..                                                               ** *   | |                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  SO4 402D  ..                                             *                 || |   | |                 *   *                                              *                                                                                                                                                                                                               
JMol viewer RasMol script viewer  NI 401D  ..                                        *    |                 || |   | |            *    |   |                                              |                                 *                                                 *                                                                                                                           
JMol viewer RasMol script viewer  G46 510T  ..           *                            *    |                 || |   | |            **   |   |                                              |                                 |                                                 * *                                                                                                                         
sec str:  ...eeeeeee.....hhhhhhhhhhhhhhhhh..eeeeee........hhhhhhhh..hhhhh...hhhhhhh........eee......hhhhhhhh...eeee..eee...eeeeee..eeeeee....hhhhh...ee...hhhhh........hhhhhhh.........eeee.....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh..eeee......eeeee..eeeee.....hhh.eeeeeee.......eehhhhhhhhhhhhhhhh...ee.....hhhhhhh..hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhh..
sequence :  ..QIQHIAIVGSVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKEKAPYLTLFIGGNHESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELWEKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELNI
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        | | ||        |  |  | ||        |||| |    | ||   |  |      || ||||          |    |     |  |   || |   |    | |  |      |  ||||| | |    | ||| |  |     |   |^*** |  |         ||| | | |           || || |   ||   | |      | | |      | |      |  ||  ||  |   |  |  |||   | | | || ||||| |  |  ||  |||| ||   |           |||   | |      | ||      |  | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | | ||        |  |  ^**|        |||^**    | ||   |  |      || ||||          |    |     |  |   || |   |    | |  |      |  ||||| | |    | ||| |  |     |   |  |  |  |         ||| | | |           || || |   ||   ^**      | | |      | |      |  ||  ||  |   |  |  |||   | | | || ||^** |  |  ||  |||^**|   |           |||   | |      ^**|      |  | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | | ||        ^***  ^***        |||| |    | ||   |  |      || ||||          |    |     |  |   || |   |    | |  |      |  |^*** | |    ^***| |  |     |   |  |  ^***         ||| | | |           || || |   ||   |        | | |      | |      |  ||  |^***   |  ^***||   | | | || || |  |  |  |^***||  ||   |           |||   | |         |      |  | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        | | ||              | |         |||| *******^|   |  ********^ ||||          |    |     |  |   || |   |    | |  |      |  ********^    | ||| |  |     |   |  |  |            ||| | | |           || || |   ||   |        | | |      | |      |  ||  |       *******^|   | | | || || |  |  |  ||   ||  ||   |           |||   | |         *******^  | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ^*****              | |         ||||      |  |   |  |      || ||||          ^*****     |  ^***** |   ^***** |  |      ^*****|  |      | ||| |  |     |   |  |  |            ||| | | |           |^*****   ||   |        | | |      | |      |  ||  |               |   | | | || || |  |  |  ||   ||  ||   |           |||   | |                   | |
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..          | |               | |         ||||      |  |   |  |      || ||||                     |  |   |  |          |  |            |  |      | ||| |  |     |   |  |  |            ||| | | |           || || |   ||   |        | | |      | |      |  ||  |               |   | | | || || |  |  |  ||   |**********************|   | |                   | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          | |               | |         ||||      |  |   |  |      || ||||                     |  |   |  |          |  |            |  |      | ||| |  |     |   |  |  |            ||| | | |           || || |   ||   |        | | |      | |      |  ||  |               ***** | | || || |  |  |  ||   ||  ||   |           | |   | |                   | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | |               | |         ||||      |  |   |  |      || ||||                     |  |   |  |          |  |            |  |      | ||| |  |     |   |  |  |            ||| | ***           || || |   ||   |        | | |      | |      |  ||  |                     | | || || |  |  |  ||   ||  ||   |           | |   ***                   | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |               | |         ||||      ****   ****      |****||                     ****   ****          ****            ****      ****| |  |     |   |  |  |            |****               ****| |   ||   |        | | |      | |      ****|  |                     | ******* |  |  |  ||   ||  ||   |           | |   | |                   | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |               | |         ||||      |  |             |  ||||                            |  |                          |  |      | | | |  |     |   |  |  |            | |                  |  | |   ||   |        *** |      | |      |  ||  |                     |   |  |  |  |  |  ||   ||  ||   |           | |   | |                   | |
search RasMol script viewer Motif-ligand binding stats  nest ..          ***               ***         ****      |  |             |  ****                            |  |                          |  |      | | | |  |     |   |  |  |            ***                  |  | |   ||   |          ***      | |      |  ||  |                     |   |  |  |  |  |  ||   ||  ||   |           | |   | |                   ***
search RasMol script viewer Motif-ligand binding stats  niche ..                            | |                   ****             |    |                             ****                          ****      | | | ****     |   |  ****                                 **** |   ||   |                   ***      ********                     |   |  *******  ****|   |****|   |           ***   ***                      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                            | |                                    ******                                                                     | | |          |   |                                            |   ||   |                                                         |   |               |   |    |   |                                          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                            | |                                                                                                               *****          |   |                                            *****|   |                                                         |   |               *****    *****                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                            | |                                                                                                               | |            *****                                                 *****                                                         *****                                                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                            ***                                                                                                               ***                                                                                                                                                                                                            

chain Y : RNA (5'-R(*UP*AP*AP*CP*A)-3')
JMol viewer RasMol script viewer  G46 510T  .. *
sec str:  ....
sequence :  ..AA
seq num:  ..500

Assembly 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : RNA LARIAT DEBRANCHING ENZYME, PUTATIVE
member of: GENE3D:searchG3DSA_3.60.21.10PANTHER:searchPTHR12849PFAM:searchPF00149SUPERFAMILY:searchSSF56300UniProt:searchC4M1P9
JMol viewer RasMol script viewer  SO4 402E  ..                                             *                                            *   *                                                                                                                                                                                                                                                             
JMol viewer RasMol script viewer  NI 401E  ..                                        *    |                                       *    |   |                                                                                *                                                 *                                                                                                                          
sec str:  ...eeeeeee.....hhhhhhhhhhhhhhhhh..eeeeee........hhhhhhhh..hhhhh...hhhhhhh........eee......hhhhhhhh...eeee..eee...eeeeee..eeeeee....hhhhh...ee...hhhhh........hhhhhhhhhhh.....eeee.....hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh..eeee......eeeee..eeeee.....hhh.eeeeeee.......eehhhhhhhhhhhhhhhh...ee.....hhhhhhhh.hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhh.
sequence :  ..QIQHIAIVGSVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQMGDFHLYYEGKEKAPYLTLFIGGNHESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRIVGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNYVIQMLSNLSQSSQIDISLSHDWPQGIVMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCEYHAEEGPTHFIALGKIGYKNAISYLDLPLKQKTDLEYDKDWVCNLIMTWPAFSNKAQFPDLSYSISELLSKRTKELDKKIIELWEKYIGLKIIYDSDTFDIQFTSRRFYIEKIYNELN
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        | | ||        | ||  | ||        |||| |   || ||   |  |       | ||||          |    |        |   || |   |    | |  |      |  ||||| | |    |  |  |  |        | ^*** |  |         ||| |         |  |  || || |   ||   | |      | |        | |      |  ||  ||  |   |  |  |||   | | | || ||||| |  | |||  |||| |                |||   | |      | ||      |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | | ||        | ||  ^**|        |||^**   || ||   |  |       | ||||          |    |        |   || |   |    | |  |      |  ||||| | |    |  |  |  |        |  ||  |  |         ||| |         |  |  || || |   ||   ^**      | |        | |      |  ||  ||  |   |  |  |||   | | | || ||^** |  | |||  |||^**                |||   | |      ^**|      |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | | ||        ^***  ^***        |||| |   || ||   |  |       | ||||          |    |        |   || |   |    | |  |      |  |^*** | |    ^***  |  |        |  ||  ^***         ||| |         |  |  || || |   ||   |        | |        | |      |  ||  |^***   |  ^***||   | | | || || |  |  | ||^***||  |                |||   | |         |      |  | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        | | ||          |   | |         |||| *******^|   |  ********^ ||||          |    |        |   || |   |    | |  |      |  ********^    |  |  |  |        |  ||  |            ||| |         |  |  || || |   ||   |        | |        | |      |  ||  |       *******^|   | | | || || |  |  | |||   ||  |                |||   | |         *******^  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ^*****          |   | |         ||||     || ||   |  |         ||||          ^*****        ^***** |   ^***** |  |      ^*****|  |      |  |  |  |        |  ||  |            ||| |         |  |  |^*****   ||   |        | |        | |      |  ||  |               |   | | | || || |  |  | |||   ||  |                |||   | |                |  | 
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..          | |           |   | |         ||||     || ||   |  |         ||||                            |  |          |  |         |  |  |      |  |  |  |        |  ||  |            ||| |         |  |  || || |   ||   |        | |        | |      |  ||  |               |   | | | || || |  |  | |||   |**********************|   | |                |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          | |           |   | |         ||||     || ||   |  |         ||||                            |  |          |  |         |  |  |      |  |  |  |        |  ||  |            ||| |         |  |  || || |   ||   |        | |        | |      |  ||  |               ***** | | || || |  |  | |||   ||  |                | |   | |                |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | |           |   | |         ||||     || ||   |  |         ||||                            |  |          |  |         |  |  |      |  |  |  |        |  ||  |            ||| |         |  |  || || |   ||   |        | |        | |      |  ||  |                     | | || || |  |  ***||   ||  |                | |   ***                |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |           |   | |         ||||     *****   ****         ||||                            ****          ****         ****  |      ****  |  |        ****|  |            |****         ****  ****| |   ||   |        | |        | |      ****|  |                     | ******* |  |  |  ||   ||  |                | |   | |                **** 
search RasMol script viewer Motif-ligand binding stats  nest ..          ***           |   ***         ****      |  |                ****                            |  |                          |  |            |  |            |  |            ***                  |  | |   ||   |        | |        | |      |  ||  |                     |   |  |  |  |  |  ||   ||  |                | |   | |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                        |   | |                   ****                                                ****                          ****            ****            ****                                 **** |   ||   |        ***        ***      ********                     |   |  *******  ****|   |****                ***   ***                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        |   | |                                                                                                                                                                               *****|   |                                                         |   |               *****                                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        ***** |                                                                                                                                                                                    *****                                                         *****                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                            ***                                                                                                                                                                                                                                                                                                                             

chain Z : RNA (5'-R(*UP*AP*AP*CP*A)-3')
JMol viewer RasMol script viewer  NI 401E  ..  *
JMol viewer RasMol script viewer  G46 501U  ..* |
sec str:  .....
sequence :  ..ACA
seq num:  ..501

   New search    4pei:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors