triangle PDBeMotif: 4oin  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.7.6
Classification transcription, transferase/antibiotic    | release date: Mon, Jan 20, 2014
Title crystal structure of thermus thermophilus transcription init complex soaked with ge23077
Authors E.ARNOLD, R.H.EBRIGHT, Y.ZHANG
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search ZN ZN binding statistics ZN   search MB8 MB8 binding statistics MB8
Modified residues:  search 2RA 2RA binding statistics 2RA search FGL FGL binding statistics FGL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
Chain C sequence:
MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
Chain D sequence:
MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
Chain E sequence:
MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
Chain F sequence:
MGSSHHHHHHSSGLVPRGSHMKKSKRKNAQAQEAQETEVLVQEEAEELPEFPEGEPDPDLEDPDLTLEDDLLDLPEEGEG
LDLEEEEEDLPIPKISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSAR
VRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGL
IRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWD
AKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGRE
HTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
Chain I sequence:
AXXXXXG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA-DIRECTED RNA POLYMERASE SUBUNIT ALPHA
member of: GENE3D:searchG3DSA_1.10.150.20/searchG3DSA_2.170.120.12/searchG3DSA_3.30.1360.10HAMAP:searchMF_00059PANTHER:searchPTHR32108/searchPTHR32108_SF0PFAM:searchPF01000/searchPF01193/searchPF03118PRODOM:searchPD001179SMART:searchSM00278/searchSM00662SUPERFAMILY:searchSSF47789/searchSSF55257/searchSSF56553TIGRFAMS:searchTIGR02027UniProt:searchQ5SHR6
sec str:  ........eeeeeee...eeeeeeeee..hhhhhhhhhhhhhhhhh..eeeeeeeee...............hhhhhhhhhh...eee......eeeeeeeee..eeee.hhh.....eee.....eeeee....eeeeeeeeeee..eehhhhhh.......ee..ee...eeeeeeeeeeeee..eeeeeeeeeeeee....hhhhhhhhhhhhhhhhhhhhhh.......
sequence :  ..SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        ^**  |  |        | ||| |  |   |   | | |    |  |  | |  | |  |         || ||     | ||                |  |  |  |   |  |   | ||||   |               | |  |  |     | | |||          | || ||  ^**   |||||  ||        | | ||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             |  |        | ||| |  |   |   | | |    |  |  | |  | |  |         || ||     | ||                |  |  |  |   |  |   ^***||   |               | |  |  |     | | |||          | |^***        ||||^***|        | | ||          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             |  |        | ||^*****   |   | | ^*****  |  | |  | |  |         || ||     | ||                |  |  |  |   |  |     | ^*****               | |  |  |     | | |||          | |  |         |||||   |        | | ||          
search RasMol script viewer Motif-ligand binding stats  asxturn ..             |  |        | ||| |      |   | |         |  | |  | |  |         || ||     ***|                |  |  |  |   |  |     |  |                   | |  |  |     | | |||          | |  |         ***||   |        | | ||          
search RasMol script viewer Motif-ligand binding stats  betabulge ..             |  |        | ||| |      |   | |         |  | |  | |  |         || ||     |  |                |  |  |  |   |  |     |  |                   | |  |  |     | | |**          | |  |         |||||   |        | | ||          
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |        ****| |      |   | |         **** |  | |  |         ****|     |  |                |  |  |  |   |  |     ****                   | |  |  |     | | |            | |  |         |||||   |        | ****          
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |          *** |      |   | |         |  | |  | |  |          |  |     |  |                |  |  |  |   |  |     |  |                   ***  |  |     | | |            | |  |         ****|   |        |   |           
search RasMol script viewer Motif-ligand binding stats  niche ..             ****          |   |      |   ***         **** **** ****          ****     ****                ****  ****   ****     ****                        ****     *****            ******             |   |        |   |           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                           |   |      |   |                                                                                                                             | |                               *****        |   |           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           *****      *****                                                                                                                             | |                                            *****           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                        ***                                                            

chain B : DNA-DIRECTED RNA POLYMERASE SUBUNIT ALPHA
member of: GENE3D:searchG3DSA_1.10.150.20/searchG3DSA_2.170.120.12/searchG3DSA_3.30.1360.10HAMAP:searchMF_00059PANTHER:searchPTHR32108/searchPTHR32108_SF0PFAM:searchPF01000/searchPF01193/searchPF03118PRODOM:searchPD001179SMART:searchSM00278/searchSM00662SUPERFAMILY:searchSSF47789/searchSSF55257/searchSSF56553TIGRFAMS:searchTIGR02027UniProt:searchQ5SHR6
JMol viewer RasMol script viewer  MG 2004D  ..                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  MG 2001B  ..                                                                                                                                                                                                                                   
sec str:  ..........eeeeeee...eeeeeeeee..hhhhhhhhhhhhhhhhh.eeeeeeeeee...............hhhhhhhhhhh..eee......eeeeeeeee..eeee.hhh.....eee.....eeeee....eeeeeeeeeeee.eehhhhhh.......ee..ee...eeeeeeeeeeeee..eeeeeeeeeeeee....hhhhhhhhhhhhhhhhhhhhh..
sequence :  ..LDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNP
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          ^**  |  |        | |||    |   |  || | |    |  |  | |  | |  | ||   | | ||||     |  |                |  |  |  |   |  | ||| ||||   |               | |  |  |     | | |||          | || ||  ^**   |||||  ||                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..               |  |        | |||    |   |  || | |    |  |  | |  | |  | ||   | | ||||     |  |                |  |  |  |   |  | ||^***||   |               | |  |  |     | | |||          | |^***        ||||^***|                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..               |  |        | ||^*****   |  || | ^*****  |  | |  | |  | ||   | | ||||     |  |                |  |  |  |   |  | ||  | ^*****               | |  |  |     | | |||          | |  |         |||||   |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..               |  |        | |||        |  || |         |  | |  | |  | ||   | *****|     |  |                |  |  |  |   |  | ||  |  |                   | |  |  |     | | |||          | |  |         |||||   |                  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..               |  |        | |||        |  || |         |  | |  | |  | |***** | || |     |  |                |  |  |  |   |  | ||  |  |                   | |  |  |     | | |||          | |  |         |||||   |                  
search RasMol script viewer Motif-ligand binding stats  betabulge ..               |  |        | |||        |  || |         |  | |  | |  | |      | || |     |  |                |  |  |  |   |  | **  |  |                   | |  |  |     | | |**          | |  |         |||||   |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..               |  |        ****|        |  || |         **** |  | |  | |      **** |     |  |                |  |  |  |   |  |     |  |                   | |  |  |     | | |            | |  |         |||||   |                  
search RasMol script viewer Motif-ligand binding stats  nest ..               |  |          ***        |  || |         |  | |  | |  | |        |  |     |  |                |  |  |  |   |  |     |  |                   ***  |  |     | | |            | |  |         ****|   |                  
search RasMol script viewer Motif-ligand binding stats  niche ..               ****                     |  ****         **** **** ******        ****     ****                ****  ****   ****     ****                        ****     *****            ******             |   |                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                        |   |                                                                                                                                                               *****                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                        *****                                                                                                                                                                                      

chain C : DNA-DIRECTED RNA POLYMERASE SUBUNIT BETA
member of: GENE3D:searchG3DSA_2.30.150.10/searchG3DSA_2.40.270.10/searchG3DSA_2.40.50.100/searchG3DSA_2.40.50.150/searchG3DSA_3.90.1100.10/searchG3DSA_3.90.1110.10HAMAP:searchMF_01321PANTHER:searchPTHR20856/searchPTHR20856_SF20PFAM:searchPF00562/searchPF04560/searchPF04561/searchPF04563/searchPF04565/searchPF10385PROSITE PATTERNS:searchPS01166, SUPERFAMILY:searchSSF64484TIGRFAMS:searchTIGR02013UniProt:searchQ8RQE9
JMol viewer RasMol script viewer  MB8 101I  ..                                                        ..                                                                                                                                                                                                                                                                                                                                                                                             *   *                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              
sec str:  ....eee.............hhhhhhhhhhhhh...hhhhh...hhhhhhhhhh.......eeeeeeeeee.....hhhhhhhh....eeeeeeeeeeee.....eeeeeeeeeeee.......eee..eeeee.eeeee..eeeeee.......eeeeee........eeeee.....eeeee...eeehhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.....hhhhhhhhhhhhh........hhhhhhhhhhhhh........eeee..eeee.hhhhhhhhhhhhhhh..............eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh.hhhhhhhhhhhhhhh..eee....hhhhhhhhhheee............hhhhhh.hhhhh................eee.....ee.....eeeeeeeee..eeeeeeeeehhhhhh..eee.....ee..ee....eeeee..eeeeehhhhh.eee.hhhhhh..hhhhh.hhhhhhhhhhhhhhhhhh............ee..hhhhhhhhh...ee....eeeeee...eeeeee....eeeee....ee.....ee..ee......ee....eeee...ee..ee...eeeeeee......hhhhheeeehhhhhh....eeeeeeeeeeee.......ee.........................ee....eee.eeee......hhhhhhhhhhhh.....eee..ee......eeeeeeeeee...........eeeeeeeeeeeee......eeee....eeeeeeeehhhhh..........eeehhhhh.....hhhhhhhhhhhhhhhhh.eee.......hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhh.......hhhhhhhhhhh..ee..............eeeeeeeeee...hhhhhheee......................eehhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh........hhhhhhhhhhhhh..eeeeee.....ee.........
sequence :  ..MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEE..GLVLDFLEYRLGEPPFPQDECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIASIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFTLLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGHEVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVTDEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALMGSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRMNLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPEEQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASK
seq num:  ..1         11        21        31        41        51    ..63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773       783       793       803       813       823       833       843       853       863       873       883       893       903       913       923       933       943       953       963       973       983       993       1003      1013      1023      1033      1043      1053      1063      1073      1083      1093      1103      1113  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..      | |               | |  ||||||| ||| ||    |        ..                     | | | |              | |                | |                        | ||  |       | |||       | ||| | |           || |||| |     |  |    |  |                    |  |              | ||  |             |||  ||||            |   | | |   || |  |   | ||| ||   | ||  |                 |  ||  ||| | ||             | | ||      |  || || **^* ||  |  |  |  |  | || ||| |       |  ||||   |  |  | |||         |   |||    |  ||  |   |  |  || |  |              || ||     ||| ||  || || ||| |          || ||  |  |  | | ||||      ||||         || |  |      | |           | |||  |     |  |  |  | || |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  | ||   | |     |  ||     | |      | | | |  |      | | || |  |  |  |||            | ||     | |  |      |  |  | |||  |   | |    | |  |   |   |  ||| |    |  |                  |  || | |  | |          |||||  ||  ||   || |||       | | | |           | || ||||           | |    | ||||    |     || |||  ||||  | || |            | |     |  || |     || |||   | |||||    | | || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |               ^**  ||||||| ||| ||    |        ..                     | | | |              | |                | |                        | ||  |       | |||       | ||| ^**           || |||| |     |  |    |  |                    |  |              | ||  |             |||  ^**|            |   ^** |   || |  |   | ||| ||   | ||  |                 |  ||  ||| | ||             | | ||      |  |^**|  | | ||  |  |  |  |  | || ||| |       |  ||||   |  |  | |||         |   |||    |  ||  |   |  |  || |  |              || ||     ^** ||  || || ||| |          || ||  |  |  | | ||||      ||||         || |  |      | |           | |||  |     |  |  |  | || |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  | ||   ^**     |  ||     | |      | ^** |  |      ^** || |  |  |  |||            | ||     | |  |      |  |  | |||  |   | |    | |  |   |   |  ||| |    |  |                  |  || | |  | |          |||||  ||  ||   || |||       | | | |           | || ||||           | |    | ||||    |     || |||  ||||  ^**| |            | |     |  |^**     || |||   | |||||    | | |^*
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |                    ||||||| ||| ||    |        ..                     | | | |              | |                | |                        | ||  |       | |||       | |||               || |||| |     |  |    |  |                    |  |              | ||  |             |||   | |            |   |   |   || |  |   | ||| ||   ^***  |                 |  ||  ||| | ||             | | ||      |  ||  |  | | ||  |  |  |  |  | || ||| |       |  ||||   |  |  | |||         |   |||    ^***|  |   |  ^***| |  |              ^***|      || ||  || || ||| |          || ||  |  |  | | ^***      ||||         || |  |      | |           | ||^***     |  |  |  | || |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  | ||           ^***|     | |      | |   |  |          || |  |  |  |||            | ||     | |  |      |  |  | ||^***   | |    | |  |   |   |  ||| |    |  |                  |  || | |  | |          |||||  |^***|   || |||       | | | |           | || ||||           | |    | ||||    |     || |||  ^***  |  | |            | |     ^***        || |||   ^***|||    | | || 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      | |                    ||||||| ||| ||    |        ..                     ******^              | |                | |                        | ||  |       | |||       | |||               || |||| |     |  |    |  |                    |  |              | ||  |             |||   | |            |   |   |   || |  |   | ||| ||     |   |                 |  ||  ||| | ||             | | ||      |  ||  |  | | ||  |  |  |  |  | || ||| |       |  ||||   |  |  | |||         |   |||    |   |  |   |  |   | |  |              || ||      || ||  || || ||| |          || ||  |  |  | | ||||      ||||         || |  |      | |           | |||        |  |  |  | || |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  | ||           |  ||     | |      | |   |  |          || |  |  |  |||            | ||     | |  |      |  |  | |||      | |    | |  |   |   |  ||| |    |  |                  |  || | |  | |          |||||  ||   |   || |||       | | | |           | || ||||           | |    | ||||    |     || |||   ||   |  | |            | |                 || |||     | |||    | | || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | |                    ||||||| ||| |^*****        ..                       | |                | |                | |                        | ||  |       | |||       | |||               || |||| |     |  |    |  |                    |  |              | ||  |             |^***** |            |   |   |   || |  |   | ||| ||     |   |                 |  ^*****| | ||             | | ||      |  ||  |  | | ||  |  |  |  |  | || ||| |       ^*****|   |  |  | |||         ^*****|    |   |  |   |  |   ^*****              || ||      || ||  || || ||| |          || ||  |  |  | | ||||      ||||         || |  |      | |           | |||        |  |  |  | || |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  | ||           |  ||     | |      | |   |  |          || |  |  |  |||            | ||     | |  |      |  |  | |||      | |    | |  |   |   |  ||| |    |  |                  |  || | |  | |          |||||  ||   |   || |||       | | | |           | || ||||           | |    | |||^*****     || |^*****|   |  | |            | |                 || |||     | |||    | | || 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      | |                    ||||||| ||| |              ..                       | |                | |                | |                        | ||  |       | |||       | |||               || |||| |     |  |    |  |                    |  |              | ||  |             | |   | |            |   |   |   || |  |   | ||| ||     |   |                 |  ||  | | | ||             | | ||      |  ||  |  | | ||  |  |  |  |  | || ||| |       |  || |   |  |  | |||             | |    |   |  |   |  |   | |                 || ||      || ||  || || ||| |          || ||  |  |  | | ||||      ||||         || |  |      | |           | |||        |  |  |  | || |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  | ||           |  ||     | |      | |   |  |          || |  |  |  |||            | ||     | |  |      |  |  | |||      | |    | |  |   |   |  ||| |    |  |                  ^***| | |  | |          |||||  ||   |   || |||       | | | |           | || ||||           | |    | |||           || |||    |   |  | |            | |                 || |||     | |||    | | || 
search RasMol script viewer Motif-ligand binding stats  RGD ..      | |                    ||||||| ||| |              ..                       | |                | |                | |                        | ||  |       | |||       | |||               || |||| |     |  |    |  |                    |  |              | ||  |             | |   | |            |   |   |   || |  |   | ||| ||     |   |                 |  ||  | | | ||             | | ||      |  ||  |  | | ||  |  |  |  |  | || ||| |       |  || |   |  |  | |||             | |    |   |  |   |  |   | |                 || ||      || ||  || || ||| |          || ||  |  |  | | ||||      ||||         || |  |      | |           | |||        |  |  |  | || |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  | ||           |  ||     | |      | |   |  |          |***  |  |  |||            | ||     | |  |      |  |  | |||      | |    | |  |   |   |  ||| |    |  |                  |  || | |  | |          |||||  ||   |   || |||       | | | |           | || ||||           | |    | |||           || |||    |   |  | |            | |                 || |||     | |||    | | || 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..      | |                    ||||||| ||| |              ..                       | |                | |                | |                        | ||  |       | |||       | |||               || |||| |     |  |    |  |                    |  |              | ||  |             | |   | |            |   |   |   || |  |   | ||| ||     |   |                 |  ||  | | | ||             | | ||      |  ||  |  | | ||  |  |  |  |  | || ||| |       |  || |   |  |  | |||             | |    |   |  |   |  |   | |                 || ||      || ||  || || ||| |          || ||  |  |  | | ||||      ||||         || |  |      | |           | |||        |  |  |  | || |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  | ||           |  ||     | |      | |   |  |          |  |  |  |  |||            | ||     | |  |      |  |  | |||      | |    | |  |   |   |  ||| |    |  |                  |  || | |  | |          |********   |   || |||       | | | |           | || ||||           | |    | |||           || |||    |   |  | |            | |                 || |||     | |||    | | || 
search RasMol script viewer Motif-ligand binding stats  RNA_POL_BETA ..      | |                    ||||||| ||| |              ..                       | |                | |                | |                        | ||  |       | |||       | |||               || |||| |     |  |    |  |                    |  |              | ||  |             | |   | |            |   |   |   || |  |   | ||| ||     |   |                 |  ||  | | | ||             | | ||      |  ||  |  | | ||  |  |  |  |  | || ||| |       |  || |   |  |  | |||             | |    |   |  |   |  |   | |                 || ||      || ||  || || ||| |          || ||  |  |  | | ||||      ||||         || |  |      | |           | |||        |  |  |  | || |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  | ||           |  ||     | |      | |   |  |          |  |  |  |  |||            | *************      |  |  | |||      | |    | |  |   |   |  ||| |    |  |                  |  || | |  | |          |||||  ||   |   || |||       | | | |           | || ||||           | |    | |||           || |||    |   |  | |            | |                 || |||     | |||    | | || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |                    ||||||| ||| |              ..                       | |                | |                | |                        | ||  |       | |||       | |||               || |||| |     |  |    |  |                    |  |              | ||  |             | |   | |            |   |   |   || |  |   | |*****     |   |                 |  ||  | | | ||             | | ||      *****  |  | | ||  |  |  |  |  | || ||| |       |  || |   |  |  | |||             | |    |   |  |   |  |   | |                 || ||      || ||  || || ||| |          || ||  |  |  | | ||||      ||||         || |  |      | |           | |||        |  |  |  | || |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  | ||           *****     | |      | |   |  |          |  |  |  |  |||            |  |     | |         |  |  | |||      | |    | |  |   |   *****| |    |  |                  ***** | |  | |          |||||  ||   |   || |||       | | | |           | |*****|           | |    | |||           || |||    |   |  | |            | |                 || |||     | |||    | | || 
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | |                    ||||||| ||| |              ..                       | |                | |                | |                        ***|  |       | |||       | |||               || |||***     |  |    |  |                    |  |              | ||  |             | |   | |            |   |   |   || |  |   ***|| ||     |   |                 |  ||  | | | ||             | | ||      |  |   |  | | ||  |  |  |  |  | || ||| |       |  || |   |  |  | |||             | |    |   |  |   |  |   | |                 || ||      || ||  || || ||| |          || ||  |  |  | | ||||      ||||         || |  |      | |           | |||        |  |  |  | || |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  | ||           |  |      | |      | |   |  |          |  |  |  |  |||            |  |     | |         |  |  | |||      ***    | |  |   |   |  | | |    |  |                  |  |  | |  ***          |||||  ||   |   || |||       | | | |           | || || |           | |    | |||           || |||    |   |  | |            | |                 || |||     | |||    | | || 
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |                    ||||||| ||| |              ..                       | |                | |                | |                           |  |       | |||       | |||               || |||        |  |    |  |                    |  |              | ||  |             | |   | |            |   |   |   || |  |   |  || ||     |   |                 |  ||  | | | ||             | | ||      |  |   |  | | ||  |  |  |  |  | || ||| |       |  || |   |  |  | |||             | |    |   |  |   |  |   | |                 || ||      || ||  || || ||| |          || ||  |  |  | | ||||      ||||         ** |  |      | |           | |||        |  |  |  | ** |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  | **           |  |      | |      | |   |  |          |  |  |  |  |**            |  |     | |         |  |  | |||             | |  |   |   |  | | |    |  |                  |  |  | |               |||||  ||   |   || |||       | | | |           | || || |           | |    | |||           || |||    |   |  | |            | |                 || |||     | |||    | | || 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      | |                    ||||||| ||| |              ..                       | |                | |                | |                           |  |       | |||       | |||               || |||        |  |    |  |                    |  |              | ||  |             | |   | |            |   |   |   || |  |   |  || ||     |   |                 |  ||  | | | ||             | | ||      |  |   |  | | ||  |  |  |  |  | || ||| |       |  || |   |  |  *****             | |    |   |  |   |  |   | |                 || ||      || ||  || || ||| |          || ||  |  |  | | ||||      ||||            |  |      | |           *****        |  |  |  |    |  |                 | ||||      | ||| ||| |             | |     | ||  || | |  |  | | |  |  |  |              |  |      | |      | |   |  |          |  |  |  |  |              |  |     | |         |  |  *****             | |  |   |   |  | | |    |  |                  |  |  | |               |||||  ||   |   || |||       | | | |           | || || |           | |    | |||           || |||    |   |  | |            | |                 || |||     *****    | | || 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                    |||||****|| |              ..                       | |                | |                | |                           |  |       ****|       ****|               |****|        |  |    |  |                    |  |              | ||  |             | |   | |            |   |   |   || |  |   |  ****|     |   |                 |  ||  | | | ||             | | ||      ****   |  | | |****  |  |  |  | ****|| |       |  || |   |  |  ****|             | |    |   |  |   |  |   | |                 ****|      ****|  ****| |****          ****|  |  |  | | ||||      ||||            |  |      | |           ****|        |  |  |  |    |  |                 ****||      ****| ||| |             | |     | |****| | ****  | | ****  ****              ****      | |      | |   ****          |  |  |  ****              ****     | |         |  |  ****|             | |  |   |   **** | |    |  |                  ****  | |               |||||  ||   |   *****|       | | | |           | |**** |           | |    ****|           |****|    |   |  | |            | |                 |****|     ****|    | | || 
search RasMol script viewer Motif-ligand binding stats  nest ..      | |                    ****| |  || |              ..                       ***                ***                ***                           |  |         ***         ***               |  ***        |  |    |  |                    |  |              | ||  |             ***   | |            |   |   |   |***  |   |  ||  |     |   |                 |  ||  | | | ||             | | ||             |  | | |      |  |  |  |  |  |***       |  |***   |  |    ***             | |    |   |  |   |  |   | |                  |  |       |  |   |  | *** |           |  |  |  |  | | ****      ****            |  |      ***           | ***        |  |  |  |    |  |                   ***|      | | | *** |             | |     | ||  || | |  |  *** |  |  |  |                        ***      | |   |  |          |  |  |  |  |              |  |     ***         |  |    ***             ***  |   |        ***    |  |                        ***               ****|  ||   |      ***       *** | |           | |  |  |           ***      ***           |  ***    |   |  | |            ***                 |  ***       ***    *****| 
search RasMol script viewer Motif-ligand binding stats  niche ..      ***                     **** *******              ..                                                                                           ****                                       |    |        ****    ****                    ****              *******                   ***            |   |   |   |  ****   ********     |   |                 ******** | ****             ******             **** | |      ****  ****  ****          *******   ****                    ***    |   ****   ****   ***                  ****       ****   ****  ****           ****  ****  ***                           ****                    | | |        ****  ****    ****                   ****      | | |  ****             | |     *******| | ****      ****  ****                                 ***   ****          *******  ****              ****                 ****                         |   |               ****                                              ****|   |                    ***           ***  ****           | |                    |    |    |   |  ***                                |    |                **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                        ..                                                                                                                                      ******                                                                                                   |   |   |   |                      |   |                          |   |                | |                   | |                                                                         |   |                                                                                                                                           | | |                                                       | | |                   | |            | |                                                                                                                                                       |   |                                                                     |   |                                                      | |                    ******    |   |                                     ******                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                        ..                                                                                                                                                                                                                                               |   |   |   |                      |   |                          *****                | |                   | |                                                                         *****                                                                                                                                           *****                                                       *****                   | |            | |                                                                                                                                                       |   |                                                                     *****                                                      | |                              |   |                                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                        ..                                                                                                                                                                                                                                               *****   *****                      *****                                               | |                   | |                                                                                                                                                                                                                         | |                                                         | |                     | |            | |                                                                                                                                                       *****                                                                                                                                | |                              *****                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                        ..                                                                                                                                                                                                                                                                                                                                      ***                   ***                                                                                                                                                                                                                         ***                                                         ***                     ***            ***                                                                                                                                                                                                                                                                                            ***                                                                                                   

chain D : DNA-DIRECTED RNA POLYMERASE SUBUNIT BETA'
member of: GENE3D:searchG3DSA_2.40.40.20/searchG3DSA_2.40.50.100HAMAP:searchMF_01322PANTHER:searchPTHR19376/searchPTHR19376_SF32PFAM:searchPF00623/searchPF04983/searchPF04997/searchPF04998/searchPF05000SMART:searchSM00663SUPERFAMILY:searchSSF64484UniProt:searchQ8RQE8
JMol viewer RasMol script viewer  MG 2005D  ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ..MG ..                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  MG 2004D  ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     *                                                                                                                                                                                                                                                                                                                                                                                                            ..MG ..                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  MG 2003D  ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                * * *                                                                                                |                                                                                                                                                                                                                                                                                                                                                                                                            ..MG ..                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  ZN 2002D  ..                                                       * *            *  *                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      | | |                                                                                                |                                                                                                                                                                                                                                                                                                                                                                                                            ..ZN ..                                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  ZN 2001D  ..                                                       | |            |  |                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      | | |                                                                                                |                                                                                                                                                                                                                                                                               *                                                                                 *      *  *                                ..ZN ..                                                                                                                                                                                                                                                           
sec str:  ......eeeeee.hhhhhhhheeee....................hhhhhh..............................hhhhhhh.eeeeeeeeeee.hhhhhh..hhhhhhh..hhhhhhhhhh...eeee.....ee..ee.....eehhhhhhhhhhh.eeeee.............ee...............eeeeeeeeeeeeeeeeeeeeeeeeee..............eeee....eeee....eeeeeee....eeeeee....eeeeeee.eeeee......ee....eeeeeeeeee....eeeeeeeeeee..eeeeeeeeeeeeeeeee.....ee......ee....eeee..hhhhhee....eeeeeeeeeeeeee.eeeee...........ee....eee....ee....eeeeee....eeeee.....eee.hhhhhhhhhhh.hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.hhhh.eeeeeee.hhhhh.eee.....eeehhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..................hhhhhhh...hhhhhhh..ee...eeeeeeee.......eeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhhhhh....hhhhhhhhhhhh....eeee.....hhh.eeeeeeeee....eeehhhhhhhhh......eeeee...hhhhhhhhhhh.hhhhh..............hhhhhhhhhhhh..........ee.hhhhhhhhhhhh......eeee..eeeehhhhhhee.hhhhhhhhhhh........eeeee..eeeeehhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhh..........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeee........eeee.eee......eee.hhhhhhhhhh.......eee..eee......hhhhhhhhhhhhhh....eeee..........eeehhhhhee....ee.....hhhhhhhhhhhhhhhhh... ....hhhhhhhhhhh..............eeeeeee....eeeeee....eeeeee............ee...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh.eeeeee..........eeehhhhhhhhhhhhhhh....eeeee..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.ee...hhhhhhhhh....hhhhh......eeeehhhhhhhhhhhhhh
sequence :  ..KEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAAQVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQL... ..ITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEA
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673       683       693       703       713       723       733       743       753       763       773       783       793       803       813       823       833       843       853       863       873       883       893       903       913       923       933       943       953       963       973       983       993       1003      1013      1023      1033      1043      1053      1063      1073      1083      1093      1103      1113      1123      1133      1143      1153      1163      1173      1183      1193      1203      1213      1223          ... ..1252      1262      1272      1282      1292      1302      1312      1322      1332      1342      1352      1362      1372      1382      1392      1402      1412      1422      1432      1442      1452      1462      1472      1482      1492       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           |   ||  | ||  | |     | | |  |  | |   | |  |  |||| |  |  |    |||   |  |  ||               | |  |   | ||||  |     ||||       |    |   |  |  |  |              |  |    |  |  |  |  |  | |  |                          |  |      |  |                                  | |       |  |    |  |  | ||   |       |  |         |  |                 |  |          |  |       |  |                                 |  |  |  |  |  | |          | || |      | |            |  |           |  | |                   | | || ||        |  |      | |  || |                 | |||                     || ||    |  | |   |  |  ||| |      |  |   | |     |  ||  |                      || |  |         |  |         | || |           |  |         | |    |  |  | |  | |                 |  ||  | || || |     |  |   | | ||      | |    |  |    | |||||  |            |  |   |   |     |||||  |  | | |  |                 | |    |  ||  |     | ||         |   |||      |        |||  || ||                         ||||| ||       ||  || |      |     |  |   |   ||||                 | |||     | || ||  |  ||     |    |  |  ||    | | ||   |  |     |||| |         | |||| |   |    | || |       |  || |  || |  ||      | ||||      ||| | |           | || |  |  |  | |  || |||| | ..PS00001..         || ||| |  |   |  |       |  |      |  |      |  |    |  |  | ||   |   | |                       | |||             |  |   || | | ||  |                | |          |  | | |||| |   |  ^***  |    | |||||||   || |||    || ||||  |      | |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |   ||  | ||  | |     ^** |  |  | |   | |  |  |||| |  |  |    |||   |  |  ||               | |  |   | ||||  |     ||||       |    |   |  |  |  |              |  |    |  |  |  |  |  | |  |                          |  |      |  |                                  | |       |  |    |  |  | ||   |       |  |         |  |                 |  |          |  |       |  |                                 |  |  |  |  |  | |          | || |      | |            |  |           |  | |                   | | || ||        |  |      | |  || |                 | |||                     || ||    |  ^**   |  |  ^** |      |  |   ^**     |  ||  |                      || |  |         |  |         | || |           |  |         | |    |  |  | |  | |                 |  ||  | || || |     |  |   | | ||      | |    |  |    | |||||  |            |  |   |   |     |||||  |  ^** |  |                 | |    |  ||  |     ^**|         |   ^**      |        |||  || ||                         ||||^**|       ||  |^**      |     |  |   |   ||||                 | |||     | |^**|  |  ||     |    |  |  ||    | ^**|   |  |     |||| |         | |||^**   |    | || |       |  || |  || |  ||      | ||||      ||| | |           | || |  |  |  | |  || |||| | ..PS00005..         || ||| |  |   |  |       |  |      |  |      |  |    |  |  | ||   |   | |                       | |||             |  |   || | | ||  |                | |          |  | | ^**| |   |  | |   |    | |||||||   || |||    || ||||  |      ^**         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |   ||  ^***  | |     | | |  |  | |   | |  |  |||| |  |  |    |||   |  |  ||               | |  |   ^***|^***     ||||       |    |   |  |  ^***              |  |    |  |  |  |  |  | ^***                          |  |      |  |                                  | |       |  |    |  |  | ||   |       |  |         |  |                 |  |          |  |       |  |                                 ^***  |  |  |  | |          | || |      | |            |  |           |  | |                   | | || ||        |  |      | |  || |                 | |||                     || ||    |  | |   ^***   |  |      |  |           |  ||  |                      || |  |         |  |         | || |           |  |         | |    |  |  | |  | |                 |  ||  | || || |     |  |   | | ||      | |    ^***    | |||||  |            |  |   |   |     |||||  |      |  |                 | |    |  ||  |     ^***         |   |||      |        |||  || ||                         ||||^***       ||  ||        |     |  |   |   ||||                 | |||     | |^***  ^***|     |    |  |  ||    |    |   |  |     |||| |         | ||||     |    | || |       |  || |  || ^***|      | ||||      ||| | |           | || |  ^***  | |  |^***|| | ..PS00006..         || ||| |  |   ^***       |  |      |  |      |  |    |  |  | ||   |   | |                       | |||             |  |   || | | ||  |                | |          |  | | || | |   |  | |   |    | |||||||   || |||    |^***||  |                  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           |   ||  | |   | |     | | |  |  | |   | |  |  |||| |  |  |    |||   |  |  ||               | |  |   | | |         ||||       |    |   |  |                    |  |    |  |  |  |  |  |                               |  |      |  |                                  | |       |  |    |  |  | ||   |       |  |         |  |                 |  |          |  |       |  |                                 |  |  |  |  |  | |          | || |      | |            |  |           |  | |                   | | || ||        |  |      | |  || |                 | |||                     || ||    |  | |          |  |      |  |           |  ||  |                      || |  |         |  |         | || |           |  |         | |    |  |  | |  | |                 |  ||  | || || |     |  |   | | ||      | |    |       | |||||  |            |  |   |   |     |||||  |      |  |                 | |    |  ||  |                  |   ||*******^        |||  || ||                         ||||           ||  ||        ******^  |   |   ||||                 | |||     | || |   |   |     |    |  |  ******^    |   |  |     |||| |         | ||||     ********^ |       |  |******^ |   |      | ||||      ||| | |           | || |  |  |  | |  || | || | ..PS00007..         || ||| |  |              |  |      |  |      |  |    |  |  | ||   |   | |                       | |||             |  |   || | | ||  |                | |          |  | | || | |   |  | |   |    | |||||||   || |||    |  | ||  |                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |   ||  | |   | |     | | |  |  | |   | |  |  |||| |  |  |    |^*****  |  ||               | |  |   | | |         ||||       ^*****   |  |                    |  |    |  |  |  |  |  |                               |  |      |  |                                  | |       |  |    |  |  | ^*****       |  |         |  |                 |  |          |  |       |  |                                 |  |  |  |  |  | |          | || |      | |            |  |           |  | |                   | | || ||        |  |      ^*****| |                 | |||                     || |^*****  | |          |  |      |  |           |  ||  |                      |^*****         |  |         | || |           |  |         | |    |  |  | |  | |                 |  ||  | || || |     |  |   | | ||      | ^*****       | |||||  |            |  |   |   |     |||||  |      |  |                 | |    |  ||  |                  ^*****                |^***** ||                         ||||           ||  ||              |  |   |   ||||                 | |||     | || |   |   |     ^*****  |  ||         |   |  |     |||| |         | ||||          | || |       |  |  |  |  |   |      | ||||      ||| | |           | || |  |  |  ^*****| | |^***..PS00008..         || ||| |  |              |  |      |  |      |  |    |  |  | ^*****   | |                       | |||             |  |   || | | ||  |                | |          ^***** || | |   |  | |   |    | ||||||^***** |||    |  | ||  |                  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..           |   ||  | |   | |     | | |  |  | |   | |  |  |||| |  |  |    | |      |  ||               | |  |   | | |         ||||                |  |                    |  |    |  |  |  |  |  |                               |  |      |  |                                  | |       |  |    |  |  |  |           |  |         |  |                 |  |          |  |       |  |                                 |  |  |  |  |  | |          | || |      | |            |  |           |  | |                   | | || ||        |  |      | |   | |                 | |||                     ^***     |  | |          |  |      ^***           |  ||  |                      |  |            |  |         | || |           |  |         | |    |  |  | |  | |                 |  ||  | || || |     |  |   | | ||      | |            | |||||  |            |  |   |   |     |||||  |      ^***                 | |    |  ||  |                  |   |                 | |  || ||                         ||||           ||  ||              |  |   |   ||||                 | |||     | || |   |   |             |  ||         |   |  |     |||| |         | ||||          | || |       |  |  |  |  |   |      | ||||      ||| | |           | || |  |  |    |   | | || | ..PS00009..         || ||| |  |              |  |      |  |      |  |    |  |  |  |       | |                       | |||             |  |   || | | ||  |                | |             | | || | |   |  | |   |    ^***|||||   || |||    |  | ||  |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |   ||  | |   | |     | | |  |  | |   | |  |  |||| |  |  |    | |      *****               | |  |   | | |         ||||                |  |                    |  |    |  |  |  |  |  |                               |  |      |  |                                  | |       |  |    |  |  |  |           |  |         |  |                 |  |          |  |       |  |                                 |  |  |  |  |  | |          | || |      | |            |  |           |  | |                   | | || ||        |  |      | |   | |                 | |||                      | |     |  | |          |  |                     |  ||  |                      |  |            |  |         | || |           |  |         | |    |  |  | |  | |                 |  ||  | || || |     |  |   | | ||      | |            | |||||  |            |  |   |   |     |||||  |                           | |    |  ||  |                  |   |                 | |  || ||                         ||||           ||  ||              |  |   |   ||||                 | |||     | || |   |   |             *****         |   |  |     |||| |         | ||||          | || |       |  |  |  |  |   |      | ||||      ||| | |           | || |  |  |    |   | | || | ..alphabetamotif..         || ||| |  |              |  |      |  |      |  |    |  |  |  |       | |                       | |||             |  |   || | | ||  |                | |             | | || | |   |  | |   |    | | |||||   || |||    |  | ||  |                  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           |   ||  | |   | |     | | |  |  | |   | |  |  |||| |  |  |    | |      |  |                | |  |   | | |         ||||                |  |                    |  |    |  |  |  |  |  |                               |  |      |  |                                  | |       |  |    |  |  |  |           |  |         |  |                 |  |          |  |       |  |                                 |  |  |  |  |  | |          | || |      | |            |  |           |  | |                   | | || ||        |  |      | |   | |                 | |||                      | |     |  | |          |  |                     |  ||  |                      |  |            |  |         | || |           |  |         | |    |  |  | |  | |                 |  ||  | || || |     |  |   | | ||      | |            | |||||  |            |  |   *****     |||||  |                           | |    |  ||  |                  |   |                 | |  || ||                         ||||           ||  ||              |  *****   ||||                 | |||     | || |   |   |             |  |          |   |  |     |||| |         | ||||          | || |       |  |  |  |  |   |      | ||||      ||| | |           | || |  |  |    |   | | || | ..asxmotif..         || ||| |  |              |  |      |  |      |  |    |  |  |  |       | |                       | |||             |  |   || | | ||  |                | |             | | || | |   |  | |   |    | | |||||   || |||    |  | ||  |                  
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |   ||  | |   | |     | | |  |  ***   | |  |  |||| |  |  |    | |      |  |                | |  |   | | |         ||||                |  |                    |  |    |  |  |  |  |  |                               |  |      |  |                                  | |       |  |    |  |  |  |           |  |         |  |                 |  |          |  |       |  |                                 |  |  |  |  |  | |          ***| |      | |            |  |           |  | |                   | | || ||        |  |      | |   | |                 | |||                      | |     |  | |          |  |                     |  ||  |                      |  |            |  |         | || |           |  |         | |    |  |  | |  | |                 |  ||  | || || |     |  |   | | ||      | |            | |||||  |            |  |             |||||  |                           | |    |  ||  |                  |   |                 | |  || ||                         ||||           ||  ||              |  |   |   ||||                 | |||     | || |   |   |             |  |          |   |  |     ***| |         | ||||          | || |       |  |  |  |  |   |      | ||||      ||| | |           ***| |  |  |    |   | | || | ..asxturn..         || ||| |  |              |  |      |  |      |  |    |  |  |  |       ***                       | |||             |  |   |*** | ||  |                | |             | | || | |   |  | |   |    | | ***||   || |||    |  | ||  |                  
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |   ||  | |   | |     | | |  |  |     | |  |  |||| |  |  |    | |      |  |                | |  |   | | |         ||||                |  |                    |  |    |  |  |  |  |  |                               |  |      |  |                                  | |       |  |    |  |  |  |           |  |         |  |                 |  |          |  |       |  |                                 |  |  |  |  |  | |             | |      | |            |  |           |  | |                   | | || ||        |  |      | |   | |                 | |||                      | |     |  | |          |  |                     |  ||  |                      |  |            |  |         | || |           |  |         | |    |  |  | |  | |                 |  ||  | || || |     |  |   | | ||      | |            | |||||  |            |  |             |||||  |                           | |    |  ||  |                  |   |                 | |  || ||                         ||||           ||  ||              |  |   |   ||||                 | |||     | || |   |   |             |  |          |   |  |      | | |         | ||||          | || |       |  |  |  |  |   |      | ||||      ||| | |           |  | |  |  |    |   | | || | ..betabulge..         || ||| |  |              |  |      |  |      |  |    |  |  |  |                                 | |||             |  |   ** | | ||  |                | |             | | || | |   |  | |   |    | |  ||||   || |||    |  | ||  |                  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           |   ||  | |   | |     | | |  |  |     | |  |  |||| |  |  |    | |      |  |                | |  |   | | |         ||||                |  |                    |  |    |  |  |  |  |  |                               |  |      |  |                                  | |       |  |    |  |  |  |           |  |         |  |                 |  |          |  |       |  |                                 |  |  |  |  ******             | |      | |            |  |           |  | |                   | | || ||        |  |      | |   | |                 | |||                      | |     |  | |          |  |                     |  ||  |                      |  |            |  |         | || |           |  |         | |    |  |  | |  | |                 |  ||  | || || |     |  |   | | ||      | |            | |||||  |            |  |             |||||  |                           | |    |  ||  |                  |   |                 | |  || ||                         ||||           ||  ||              |  |   |   ||||                 *****     | || |   |   |             |  |          |   |  |      | | |         | ||||          | || |       |  |  |  |  |   |      | ||||      ||| | |           ******  |  |    |   | | || | ..betabulgeloop..         || ||| |  |              |  |      |  |      |  |    |  |  |  |                                 | |||             |  |      | | ||  |                | |             | | || | |   |  | |   |    | |  ||||   || |||    |  | ||  |                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |   ||  | |   | |     | | ****  |     | |  |  |||| |  |  |    | |      ****                | |  |   | | |         ||||                |  |                    ****    |  |  ****  |  |                               |  |      |  |                                  | |       ****    |  |  |  |           |  |         ****                 |  |          |  |       |  |                                 |  |  |  |     | |             | |      | |            |  |           |  | |                   | | ****|        ****      | |   | |                 ****|                      | |     **** |          |  |                     ********                      |  |            |  |         | || |           |  |         | |    ****  | |  | |                 |  ||  | || || |     ****   | | ||      | |            ****|||  |            |  |             ||||****                           | |    |  ||  |                  |   |                 | |  ****|                         ||||           ||  ||              |  |   |   ||||                 ****|     | || |   |   |             ****          |   |  |      | | |         ****||          | || |       ****  |  |  |   |      ****||      ||| | |              | |  |  |    |   | ****** ..betaturn..         |****| |  |              |  |      |  |      |  |    ****  |  |                                 ****|             |  |      | | ||  |                | |             | | || | |   |  | |   |    | |  ||||   |****|    **** ||  |                  
search RasMol script viewer Motif-ligand binding stats  nest ..           |   ||  | |   | |     ***    |  |     | |  |  **** |  |  |    ***                          | |  |   | ***         ****                |  |                    |  |    |  |  |  |  |  |                               |  |      |  |                                  ***       |  |    |  |  |  |           |  |                              |  |          |  |       |  |                                 |  |  |  |     ***             ***      | |            |  |           |  | |                   ***  |  |                  ***   | |                   ***                      ***     |  | |          |  |                     |  ||  |                      |  |            |  |         | || |           |  |         | |          ***  ***                 |  ||  | || |***            | | ||      ***              ****|  |            |  |             ****|  |                           ***    |  ||  |                  |   |                 ***   |  |                         ****           ||  ||              |  |   |   ****                   ***     | || |   |   |                           |   |  |      *** |           ****          | || |             |  |  |   |        ****      ||| | |              ***  |  |    |   |        ..nest..         |  *** |  |              |  |      |  |      |  |    |  |  |  |                                   ***             |  |      | | ||  |                ***             | | || | |   |  ***   |    ***  ****   |  ***    |  | ||  |                  
search RasMol script viewer Motif-ligand binding stats  niche ..           |   |**** |   ***     | |    ****     ******       *******                                 ***  |   |                                 ****                    ****    ****  ****  ****                               ****      ****                                            ****    ****  ****           ****                              ****          ****       ****                                 ****  ****                              ***            ****           ******                        ****                        | |                                                    ******          ****                     ********                      ****            ****         ******           ****         ***                                   **********| |               | ****                           ****            ****                 ****                                  ********                  |   |                 | |   ****                          ***           ||  ||              ****   |   | |                            ***| |   |   |                           |   ****        ***                         ******             ****  |   |                  |******                   ****    |   |        ..niche..         |    | ****              ****      ****      ****    ****  ****                                                   ****      *********                                | ****** |   |    |   |                |    |    **** |****                  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..           |   |   | |           | |                                                                       |   |                                                                                                                                                                                                                                                                                                                                                                                                                                       | |                                                       | |                                                                                                                                                                            | |               |   |                                                                                                                                 |   |                 | |                                               ||  ||                     |   | |                               | |   |   |                           |   |           | |                                                  |   |                  | |                               |   |        ..schellmannloop..         ******                                                                                                                                                               |   |    |   |    |   |                ******       | |                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..           *****   | |           | |                                                                       *****                                                                                                                                                                                                                                                                                                                                                                                                                                       | |                                                       | |                                                                                                                                                                            | |               |   |                                                                                                                                 |   |                 | |                                               ||  ||                     |   | |                               | |   *****                           |   |           | |                                                  *****                  | |                               |   |        ..stmotif..                                                                                                                                                                              |   |    |   |    |   |                             | |                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                   | |           | |                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   | |                                                       | |                                                                                                                                                                            | |               *****                                                                                                                                 *****                 | |                                               ******                     ***** |                               | |                                   *****           | |                                                                         | |                               *****        ..ststaple..                                                                                                                                                                              *****    *****    *****                             | |                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                   ***           ***                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   ***                                                       ***                                                                                                                                                                            ***                                                                                                                                                                           ***                                                                              ***                               ***                                                   ***                                                                         ***                                            ..stturn..                                                                                                                                                                                                                                  ***                      

chain E : DNA-DIRECTED RNA POLYMERASE SUBUNIT OMEGA
member of: GENE3D:searchG3DSA_3.90.940.10HAMAP:searchMF_00366PFAM:searchPF01192SUPERFAMILY:searchSSF63562TIGRFAMS:searchTIGR00690UniProt:searchQ8RQE7
sec str:  .....hhhhhhhhh.hhhhhhhhhhhhhhhhhhh.............eee....eee..hhhhhhhhhhhhh.eeee....hhhhhhhhhhhhh..
sequence :  ..AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPV
seq num:  ..2         12        22        32        42        52        62        72        82        92  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||| |||||  |   |            | | || ||| ||           | | |        ^**|    | |      |     |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | ||| |||||  |   |            | | |^***| ||           | | |        ||||    | |      |     |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | ||| |||||  |   |            | | || ||| ||           | | |        ||||    | |      ******^  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | ||| ||^*****   |            | | || ||| ||           | | |        ||||    | |               
search RasMol script viewer Motif-ligand binding stats  asxturn .. | ||| || ||  |   |            | | || ||| ||           *****        ||||    | |               
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****| ****|  |   |            | | || |****|           | |          ||||    | |               
search RasMol script viewer Motif-ligand binding stats  nest ..   ***  |  |  |   |            *****| | |  |           | |          ****    ***               
search RasMol script viewer Motif-ligand binding stats  niche ..        ****  |   |              ****** ****           ***          |***                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                 | |                             | |                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                    ***                             ***                       

chain F : DNA DIRECTED RNA POLYMERASE SIGMA FACTOR A
member of: GENE3D:searchG3DSA_1.10.10.10/searchG3DSA_1.10.601.10HAMAP:searchMF_00963PANTHER:searchPTHR30603/searchPTHR30603_SF6PFAM:searchPF00140/searchPF04539/searchPF04542/searchPF04545PRINTS:searchSIGMA70FCTPROSITE PATTERNS:searchPS00716, SUPERFAMILY:searchSSF88659/searchSSF88946TIGRFAMS:searchTIGR02393/searchTIGR02937UniProt:searchQ5SKW1
JMol viewer RasMol script viewer  MG 2001F  ..                                                                                                                                                                                                                                                                                                                                                          
sec str:  ...hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh..............hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh...hhhhhhhhhhhh...ee...........hhhhhh......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..hhhhh
sequence :  ..SDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD
seq num:  ..78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |               |  |               **^*  | ||             || |   | || | |   |  |    |  |                    |      |    |**^*|||||  |       |  | |  | | | |                   |  ||||   |   |  |   | |     | |  |  |     |  |   |   | |  |   | ||  | |  |  |  |      |  |                  | ||       ||||| |  |  | |  | |               |      ||||     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |               |  |                 |   | ||             |^**   | || | |   |  |    |  |                    |      |    || |^**|||  |       |  | |  | | | |                   |  |^**   |   |  |   ^**     | |  |  |     |  |   |   ^**  |   | ||  | |  |  |  |      |  |                  ^**|       ||||| |  |  | |  | |               |      ^**|     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**               ^***                 |   ^***             |  |   | || | |   ^***    |  |                    |      |    || ||||||^***       |  | |  | | | |                   |  | |    |   |  |   |       | |  ^***     |  |   |   | |  |   | ||  | |  |  |  |      ^***                  ^***       ||||| |  ^*** |  | |               |      ||||     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                                      |   | |              |  |   | || | |           |  |                    |      |    || ||||||           |  *******^ | |                   |  | |    |   |  |   |       | |           |  |   |   | |  |   | ||  | |  |  |  |                                       ||||| |  |    |  | |               |      ||||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                                      |   | |              |  |   | ^*****           |  |                    |      |    || ||||||           ^*****  |   | |                   |  | |    |   |  |   |       | |           |  |   |   | |  |   | ||  | |  |  |  |                                       |^*****  |    ^*****               |      ||||     
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..                                      |   | |              |  |   |  | |             |  |                    |      |    || ||||||                |  |   | |                   |  | |    |   |  |   |       | |           |  |   |   | |  |   | ||  | |  |  |  |                                       ||||| |  |       | |               |      ||||     
search RasMol script viewer Motif-ligand binding stats  SIGMA70_2 ..                                      |   | |              |  |   |  | |             |  |                    |      |    || ||||||                |  |   | |                   |  | |    |   |  |   |       | |           |  |   |   | |  |   | ||  | |  |  |  |                                       ||||| |  ***************************      ||||     
search RasMol script viewer Motif-ligand binding stats  CPSASE_2 ..                                      |   | |              |  |   |  | |             |  |                    ********    || ||||||                |  |   | |                   |  | |    |   |  |   |       | |           |  |   |   | |  |   | ||  | |  |  |  |                                       ||||| |          | |                      ||||     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                      |   | |              |  |   |  | |             |  |                                ****|||||                |  |   | |                   |  | |    |   |  |   |       | |           |  |   |   | |  |   | ||  | |  |  |  |                                       ||||| |          | |                      ||||     
search RasMol script viewer Motif-ligand binding stats  nest ..                                      |   ***              |  |   |  | |             |  |                                 |  |****                |  |   ***                   |  | |    |   |  |   |       ***           |  |   |   | |  |   | ||  | |  |  |  |                                       *******          ***                      ****     
search RasMol script viewer Motif-ligand binding stats  niche ..                                      |   |                ****   ******             ****                                 ****                    ****                         ******    |   |  |   |                     ****   |   | ****   ****  ******  ****                                                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                      *****                                                                                                                                              *****  *****                            *****        | |                                                                                                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                              ***                                                                                                         

chain I : GE23077
JMol viewer RasMol script viewer  MG 2003D  ..       
JMol viewer RasMol script viewer  MB8 101I  ..*      
sec str:  .........
sequence :  ..ASVXTXG
seq num:  ..1      
search RasMol script viewer Motif-ligand binding stats  nest ..   ****

chain G : 5'-D(*CP*CP*T*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TPG)-3';
sec str:  ..................
sequence :  ..GCATCCGTGAGTCGAG
seq num:  ..4         14    

chain H : 5'-D(*TP*AP*TP*AP*AP*TP*GP*GP*GP*AP*GP*CP*TP*GP*T*GP*GP*AP*TP*GP*CP*AP*GP*G)-3';
sec str:  ..........................
sequence :  ..TATAATGGGAGCTGTCACGGATGC
seq num:  ..1         11        21  

   New search    4oin:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors