triangle PDBeMotif: 4oe4  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.2.1.88
Classification oxidoreductase    | release date: Sat, Jan 11, 2014
Title crystal structure of yeast aldh4a1 complexed with nad+
Authors J.J.TANNER
Method X-RAY DIFFRACTION (resolution: 2.17Å)
PDBe Citation   
Small molecules:    search NAD NAD binding statistics NAD
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MDHHHHHHHHASENLYFQGHMKPPKHIRNEPVKPFRNIDLKDWDLLRASLMKFKSSSLEVPLVINGERIYDNNERALFPQ
TNPANHQQVLANVTQATEKDVMNAVKAAKDAKKDWYNLPFYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEID
CITELSDFFRYYVKYASDLYAQQPVESADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAAL
SNYLLMTVLEEAGLPKGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGVVEGKYRDYPRIIGETGGK
NFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLPESKSEEFLSDMFGILQSQNVVPMNTSASPISGGNLRGFMGP
VIHEQSFDKLVKVIEDAKKDPELEILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFNEICDII
DNTSQYALTGAIFAKDRKAIEYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTDDKAGGPNILSRFVSIRNTKEN
FYELTDFKYPSNYEELGSGC
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DELTA-1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASEMITOCHONDRIAL;
member of: GENE3D:searchG3DSA_3.40.309.10/searchG3DSA_3.40.605.10PANTHER:searchPTHR11699/searchPTHR11699_SF18PFAM:searchPF00171PROSITE PATTERNS:searchPS00070/searchPS00687, SUPERFAMILY:searchSSF53720TIGRFAMS:searchTIGR01236UniProt:searchP07275
JMol viewer RasMol script viewer  NAD 1000A  ..                                                                                                                                                                     ****                      *                                *   *             * **  *                           *                                                           ..NAD ..                                                            * *                        ..                                     ..                   
sec str:  ..hhhhhhhhhhhhhhh.eee.eee..eee.......eeeeee..eeeeeeeeee..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.....eeeeeeee...eeeee....hhhhhhhhhhhhhhh...eeee.hhhhhhhhhhhhhhhhhh......eee...hhhhhhhhhhh...eeeeeee.hhhhhhhhhhhhhhhhhh.......eeeee....eeeee....hhhhhhhhhhhhhhhhhhh....eeeeeeehhhhhhhhhhhhhhhhhh... ........hhhhhhhhhhhhhhhhhh..eeeeee..ee.....ee..eeeee....hhhhh......eeeeeeehhhhhhhhhhhhhh......eeeee..hhhhhhhhhhhh.....eeee.........hhhh.eeeeeeee.....
sequence :  ..DWDLLRASLMKFKSSSLEVPLVINGERIYDNNERALFPQTNPANHQQVLANVTQATEKDVMNAVKAAKDAKKDWYNLPFYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRYYVKYASDLYAQQPVESADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAALSNYLLMTVLEEAGLPKGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGVVEGKYRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLPESKSEEFLSDMFGILQSQ... ..FMGPVIHEQSFDKLVKVIEDAKKDPELEILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFNEICDIIDNT..YALTGAIFAKDRKAIEYADEKLKFSAGNFYINDKCTG..NILSRFVSIRNTKENFYEL
seq num:  ..43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373   ... ..398       408       418       428       438       448       458       468       478    ..487       497       507       517    ..547       557      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              |  |           | | |      | ||| |   ^*** | |||             |  |             |  |||           || | |                       |  |       | |      | | |  |   | ^***           | |                  | || |||| |||             |  |  |       |   |         || ||||       ||     |   |  |^***|  || |||||  | || | |    | | ||       |    |..PS00001..|                  || || ||  ||    | |            ||  |||||||| |   |  | |  |         ^*..    |   |||          |  |    |  ||  |..  || ||| |    | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              |  |           | | |      | ||| |        ^**||             |  |             |  ^**           || | |                       |  |       | |      | | |  |   | ||             | |                  | || |||| |||             |  |  |       |   |         || ||||       ||     |   |  ||  ||  |^**||||  | || | |    | | ||       |    |..PS00005..|                  || || ||  ||    | |            ||  |||||||| |   |  | |  |           ..    |   |||          |  |    |  ||  |..  || ||^**    | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              ^***           | | |      | ||| |        ^***|             |  |             |   |            || | |                       |  |       | |      | | |  |   | ||             | |                  ^*** |||| |||             |  |  |       |   |         || ||||       ||     |   |  ||  ||  ||  ||||  | || | |    | ^***       |    |..PS00006..|                  || || ||  ||    | |            ||  |||||||| |   ^*** |  |           ..    |   |||          |  |    |  ||  |..  || ||  |    | |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                             | | |      | ||| |        |   |             |  |             |   |            || | |                       |  |       | |      *******^   | ||             | |                    || |||| |||             |  |  |       |   |         || ||||       ||     |   |  ||  ||  ||  ||||  | || | |    |   |        |    |..PS00007..|                  || || ||  ||    | |            ******^||||| |        |  |           ..    |   |||          |  |    |  ||  |..  || ||  *******^  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                             | | |      | ||| |        |   |             |  |             |   |            ^*****                       |  |       | |        | |      | ||             | |                    || |^*****|             |  |  |       |   |         ^*****|       ||     |   |  ||  ||  ||  ||||  ^***** |    |   |        ^*****..PS00008..*                  || || ||  ||    | |             |  |||||||| |        |  |           ..    ^*****|          |  |    |  ||  ^..  || ||       | |  
search RasMol script viewer Motif-ligand binding stats  ALDEHYDE_DEHYDR_CYS ..                             | | |      | ||| |        |   |             |  |             |   |             | |                         |  |       | |        | |      | ||             | |                    || |||| |||             |  |  |       |   |          | ||||       ||     |   |  ||  ||  ||  ||*******^****    |   |              ..PS00070..                   || || ||  ||    | |             |  |||||||| |        |  |           ..        | |          |  |    |  ||  |..  || ||       | |  
search RasMol script viewer Motif-ligand binding stats  ALDEHYDE_DEHYDR_GLU ..                             | | |      | ||| |        |   |             |  |             |   |             | |                         |  |       | |        | |      | ||             | |                    || |||| |||             |  |  |       |   |          | ||||       *^******   |  ||  ||  ||  || |    || |      |   |              ..PS00687..                   || || ||  ||    | |             |  |||||||| |        |  |           ..        | |          |  |    |  ||  |..  || ||       | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                             | | |      | ||| |        |   |             |  |             |   |             | |                         |  |       | |        | |      | ||             | |                    || |||| |||             |  |  |       |   |          | ||||        |         |  ||  ||  ||  || |    || |      |   |              ..alphabetamotif..                   ***** ||  ||    | |             |  |*****|| |        |  |           ..        | |          |  |    |  ||  |..  || ||       | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                             | | |      ***** |        |   |             |  |             |   |             | |                         |  |       | |        | |      | ||             | |                    || |||| |||             |  |  |       |   |          | ||||        |         |  |*****  ||  || |    || |      |   |              ..asxmotif..                   || || ||  ||    | |             |  |||||||| |        |  |           ..        | |          |  |    |  ||  |..  || ||       | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..                             *** |      ***|  |        |   |             |  |             |   |             | |                         |  |       ***        | |      | ||             | |                    || |||| |||             |  |  |       |   |          | ||||        |         |  |   |   ||  || |    || |      |   |              ..asxturn..                   || |***|  ||    ***             |  |||||||| |        |  |           ..        | |          |  |    |  ||  |..  || ||       | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..                             | | |      |  |  |        |   |             |  |             |   |             | |                         |  |       | |        | |      | ||             | |                    || |||| |||             |  |  |       |   |          | ||||        |         |  |   |   ||  || |    || |      |   |              ..betabulge..                   || ||  |  **                    |  |||||||| |        |  |           ..        | |          |  |    |  ||  |..  || ||       | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                             | | |      *******        |   |             ****             |   |             | |                         ****       | |        | |      | ||             | |                    |****|****|             |  |  |       |   |          ****||        |         |  |   |   ||  || |    ****      |   |              ..betaturn..                   ****|  |                        |  *****||| |        ****           ..        | |          ****    |  |****..  ****|       | |  
search RasMol script viewer Motif-ligand binding stats  nest ..                             *****         |  |        |   |             |  |             |   |             ***                                    ***        | |      | ||             ***                    |  ***  ***             |  |  |       |   |            ****        |         |  |   |   ||  || |    || |      |   |              ..nest..                    |  |  |                        |  | |  ||***                       ..        | |                  |  |    ..   |  |       | |  
search RasMol script viewer Motif-ligand binding stats  niche ..                               ***         ****        |   |             ****             |   |                                                               ***      ****                                    |    |                  *******       |   |                        |         ****   |   ||  ****    ****      |   |              ..niche..                    *******                        **** ****|                          ..        ***                  ****    ..   ****       ***  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                       |   |                              |   |                                                                          |                                     ******                                |   |                        |                |   ||   |       |        |   |              ..schellmannloop..                                                            |                          ..                                     ..                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                       *****                              |   |                                                                          |                                                                           *****                        |                |   ||   |       |        |   |              ..stmotif..                                                            |                          ..                                     ..                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                          *****                                                                          |                                                                                                        |                **********       |        *****              ..ststaple..                                                            |                          ..                                     ..                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                         *                                                                                                        *                                 *                           ..REP00000..                                                            *                          ..                                     ..                   

chain B : DELTA-1-PYRROLINE-5-CARBOXYLATE DEHYDROGENASEMITOCHONDRIAL;
member of: GENE3D:searchG3DSA_3.40.309.10/searchG3DSA_3.40.605.10PANTHER:searchPTHR11699/searchPTHR11699_SF18PFAM:searchPF00171PROSITE PATTERNS:searchPS00070/searchPS00687, SUPERFAMILY:searchSSF53720TIGRFAMS:searchTIGR01236UniProt:searchP07275
JMol viewer RasMol script viewer  NAD 1000B  ..                                                                                                                                                                     ****                      * *                              **  *             * **  *   *                                                                                   ..NAD ..                                                                                         ..                                     ..                   
sec str:  ...hhhhhhhhhhhhhh.eee.eee..eee.......eeeeee..eeeeeeeeee..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh....ee.....eeeeeeee...eeeee....hhhhhhhhhhhhhhh...eeee.hhhhhhhhhhhhhhhhhh......eee...hhhhhhhhhh....eeeeeee.hhhhhhhhhhhhhhhhhhh......eeeee....eeeee....hhhhhhhhhhhhhhhhhhh....eeeeeeehhhhhhhhhhhhhhhhhh... ..........hhhhhhhhhhhhhhhhhh..eeeeee..ee.....ee..eeeee....hhhhh......eeeeeeehhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhh.....eeee.........hhhh.eeeeeeee.....
sequence :  ..DWDLLRASLMKFKSSSLEVPLVINGERIYDNNERALFPQTNPANHQQVLANVTQATEKDVMNAVKAAKDAKKDWYNLPFYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRYYVKYASDLYAQQPVESADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAALSNYLLMTVLEEAGLPKGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGVVEGKYRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLPESKSEEFLSDMFGILQSQ... ..RGFMGPVIHEQSFDKLVKVIEDAKKDPELEILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFNEICDIIDNT..YALTGAIFAKDRKAIEYADEKLKFSAGNFYINDKCTG..NILSRFVSIRNTKENFYEL
seq num:  ..43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373   ... ..396       406       416       426       436       446       456       466       476      ..487       497       507       517    ..547       557      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | | ||  |    |  |   | | |      | ||| |   ^*** | |||             |  ||  ||        |  ||| |         || | |                       || ||    | |||      | | |  |   | ^***        || |||                  | || |||  |||             |  |  |       |   |    |   ||| ||||       ||     |   |  |^***|  || |||||  | || | |      |  |       |    |..PS00001..  |                   |  | ||  ||    | |            ||  |||||||| |   |  |              ^*..    |   |||   |      |  |    |  ||  |..   |  || |    | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | | ||  |    |  |   | | |      | ||| |        ^**||             |  ||  ||        |  ^** |         || | |                       || ||    | |||      | | |  |   | ||          || |||                  | || |||  |||             |  |  |       |   |    |   ||| ||||       ||     |   |  ||  ||  |^**||||  | || | |      |  |       |    |..PS00005..  |                   |  | ||  ||    | |            ||  |||||||| |   |  |                ..    |   |||   |      |  |    |  ||  |..   |  |^**    | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         | | |^***    |  |   | | |      | ||| |        ^***|             |  ||  ||        |   |  |         || | |                       || ||    | |||      | | |  |   | ||          || |||                  ^*** |||  |||             |  |  |       |   |    |   ||| ||||       ||     |   |  ||  ||  ||  ||||  | || | |      ^***       |    |..PS00006..  |                   |  | ||  ||    | |            ||  |||||||| |   ^***                ..    |   |||   |      |  |    |  ||  |..   |  |  |    | |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | | ||       |  |   | | |      | ||| |        |   |             |  ||  ||        |   |  |         || | |                       || ||    | |||      *******^   | ||          || |||                    || |||  |||             |  |  |       |   |    |   ||| ||||       ||     |   |  ||  ||  ||  ||||  | || | |                 |    |..PS00007..  |                   |  | ||  ||    | |            ******^||||| |                       ..    |   |||   |      |  |    |  ||  |..   |  |  *******^  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | | ||       |  |   | | |      | ||| |        |   |             |  ||  ||        |   |  |         ^*****                       || ||    | |||        | |      | ||          || |||                    || |^*****|             |  |  |       |   |    |   |^*****|       ||     |   |  ||  ||  ||  ||||  ^***** |                 ^*****..PS00008..***                   |  | ||  ||    | |             |  |||||||| |                       ..    ^*****|   |      |  |    |  ||  ^..   |  |       | |  
search RasMol script viewer Motif-ligand binding stats  ALDEHYDE_DEHYDR_CYS ..         | | ||       |  |   | | |      | ||| |        |   |             |  ||  ||        |   |  |          | |                         || ||    | |||        | |      | ||          || |||                    || |||  | |             |  |  |       |   |    |   | | ||||       ||     |   |  ||  ||  ||  ||*******^****                       ..PS00070..                      |  | ||  ||    | |             |  |||||||| |                       ..        | |   |      |  |    |  ||  |..   |  |       | |  
search RasMol script viewer Motif-ligand binding stats  ALDEHYDE_DEHYDR_GLU ..         | | ||       |  |   | | |      | ||| |        |   |             |  ||  ||        |   |  |          | |                         || ||    | |||        | |      | ||          || |||                    || |||  | |             |  |  |       |   |    |   | | ||||       *^******   |  ||  ||  ||  || |    || |                         ..PS00687..                      |  | ||  ||    | |             |  |||||||| |                       ..        | |   |      |  |    |  ||  |..   |  |       | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | | ||       |  |   | | |      | ||| |        |   |             |  |*****        |   |  |          | |                         || ||    | |||        | |      | ||          || |||                    || |||  | |             |  |  |       |   |    |   | | ||||        |         |  ||  ||  ||  || |    || |                         ..alphabetamotif..                      |  | ||  ||    | |             |  |*****|| |                       ..        | |   |      |  |    |  ||  |..   |  |       | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         | | ||       |  |   | | |      ***** |        |   |             |  ||  |         |   |  |          | |                         || ||    | |||        | |      | ||          || |||                    || |||  | |             |  |  |       |   |    |   | | ||||        |         |  |*****  ||  || |    || |                         ..asxmotif..                      |  | ||  ||    | |             |  |||||||| |                       ..        | *****      |  |    |  ||  |..   |  |       | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | | ||       |  |   | | |      ***|  |        |   |             |  ||  |         |   |  |          | |                         || ||    | |||        | |      | ||          || |||                    || |||  | |             |  |  |       |   |    |   | | ||||        |         |  |   |   ||  || |    || |                         ..asxturn..                      |  ***|  ||    ***             |  |||||||| |                       ..        | |          |  |    |  ||  |..   |  |       | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..         | | ||       |  |   | | |      |  |  |        |   |             |  ||  |         |   |  |          | |                         || ||    | |||        | |      | ||          || |||                    || |||  | |             |  |  |       |   |    |   | | ||||        |         |  |   |   ||  || |    || |                         ..betabulge..                      |  |  |  **                    |  |||||||| |                       ..        | |          |  |    |  ||  |..   |  |       | |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         | | ||       |  |   | | |      |  |  |        |   |             |  ||  |         |   |  |          | |                         || ||    *****        | |      | ||          || |||                    || |||  | |             |  |  |       |   |    |   | | ||||        |         |  |   |   ||  || |    || |                         ..betabulgeloop..                      |  |  |                        |  |||||||| |                       ..        | |          |  |    |  ||  |..   |  |       | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | | ||       ****   | | |      ****  |        |   |             |  |****         |   ****          | |                         ****|    ****|        | |      | ||          |****|                    |****|  | |             |  |  |       |   |    |   | ****||        |         |  |   |   ||  || |    ****                         ..betaturn..                      |  |  |                        |  *****||| |                       ..        | |          ****    |  |****..   |  |       | |  
search RasMol script viewer Motif-ligand binding stats  nest ..         | | ||              *****         |  |        |   |             |  |             |   |             ***                          |  |      ***        | |      | ||          |  ***                    |  ***  ***             |  |  |       |   |    |   |   ****        |         |  |   |   ||  || |    || |                         ..nest..                      |  |  |                        |  | |  ||***                       ..        | |                  |  |    ..   |  |       | |  
search RasMol script viewer Motif-ligand binding stats  niche ..         | ****                            ****        |   |             ****             |   |                                          ****                 ***      ****          |    |                    |    |                  *******       |   |    |   |    ***        |         ****   |   ||  ****    ****                         ..niche..                      *******                        **** ****|                          ..        ***                  ****    ..   ****       ***  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..         |   |                                         |   |                              |   |                                                                          |           ******                    ******                                |   |    |   |               |                |   ||   |       |                           ..schellmannloop..                                                              |                          ..                                     ..                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..         |   |                                         *****                              |   |                                                                          |                                                                           *****    |   |               |                |   ||   |       |                           ..stmotif..                                                              |                          ..                                     ..                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..         *****                                                                            *****                                                                          |                                                                                    *****               |                **********       |                           ..ststaple..                                                              |                          ..                                     ..                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                         *                                                                                                        *                                 *                           ..REP00000..                                                              *                          ..                                     ..                   

   New search    4oe4:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors