triangle PDBeMotif: 4o65  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification oxidoreductase    | release date: Fri, Dec 20, 2013
Title crystal structure of the cupredoxin domain of amob from nitr yellowstonii
Authors A.C.ROSENZWEIG, J.HAM, T.J.LAWTON, T.SUN
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search CU CU binding statistics CU   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
HGVQAQLQSRFVKIEDETFSATRLITKAEFAKRTFGNSDLETLKQVDAMGCDPARRQDVLIVTGRLVSQVKQDLNAWISL
FTEASNAGNRWEFISRDPPGNVFTIPGGGEVPYKLCLSALEPGTYHAHTQLNIASVGPGLGPGMSIVVEGEPTEKPSAWS
HPQFEK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PUTATIVE ARCHAEAL AMMONIA MONOOXYGENASE SUBUNIT B
member of: GENE3D:searchG3DSA_2.60.120.570PFAM:searchPF04744UniProt:searchB0LKZ4
JMol viewer RasMol script viewer  SO4 203A  ..                                                                             ..                                                                        *   
JMol viewer RasMol script viewer  SO4 202A  ..                                                                       *     ..                                             **                         |   
JMol viewer RasMol script viewer  CU 201A  ..                                                                       |     ..                                     * *     ||                         |   
sec str:  ........eeeeeeee...eeehhhhhhhhhhh..hhhhhhhhhh..........eeeeeeeeee.....eeeeeeee.....eeeeeee.....eee....eeeeeeeeee...eeeeeeeeeee...eeee...eeeeee...............
sequence :  ..QLQSRFVKIEDETFSATRLITKAEFAKRTFGNSDLETLKQVDAMGCDPARRQDVLIVTGRLVSQVKQDLNAWISLFT..NRWEFISRDPPGNVFTIPGGGEVPYKLCLSALEPGTYHAHTQLNIASVGPGLGPGMSIVVEGEPTEKPSAWSHPQF
seq num:  ..36        46        56        66        76        86        96        106    ..119       129       139       149       159       169       179       189   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | || |  |        |  ||   || ||| |^** || ||  | ||  |   ^**                 ..     ||  | |    |            |  | |    |    | ||| |    |        ^** | |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | || |  |        ^***|   || |^***    || ||  | ||  |                       ..     ||  | |    |            ^*** |    |    | ||| |    |            | |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | || |  |        |   |   || | |      || |^*****|  |                       ..     ||  | ^*****                 ^*****    | ||| ^*****            | |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | || |  |        |   |   || ***      || ||  |  |  |                       ..     ||  | |                                | |||                   | |     
search RasMol script viewer Motif-ligand binding stats  betabulge ..   | || |  |        |   |   || | |      || ||  |  |  |                       ..     **  | |                                | |||                   | |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | || |  |        |   |   || | |      *****  |  |  |                       ..         | |                                ****|                   | |     
search RasMol script viewer Motif-ligand binding stats  nest ..   | || |  |        |   |   |*** |             |  |  |                       ..         | |                                  ***                   | |     
search RasMol script viewer Motif-ligand binding stats  niche ..   **** ****        |   |   |  ***             *******                       ..         ***                                                        ***     
search RasMol script viewer Motif-ligand binding stats  stmotif ..   | |              *****   |                                                ..                                                                    | |     
search RasMol script viewer Motif-ligand binding stats  ststaple ..   | |                  *****                                                ..                                                                    | |     
search RasMol script viewer Motif-ligand binding stats  stturn ..   ***                                                                       ..                                                                    ***     

   New search    4o65:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors