triangle PDBeMotif: 4n7x  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transport protein    | release date: Wed, Oct 16, 2013
Title the e254a mutant of the sodium bile acid symporter from yers frederiksenii
Authors E.J.LEVIN, M.ZHOU, NEW YORK CONSORTIUM ON MEMBRANE PROT, STRUCTURE (NYCOMPS), X.ZHOU
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
RAHHHMLVKITRLFPVWALLLSVAAYFRPTTFTGIGPYVGPLLMLIMFAMGVTLRLDDFKRVLSRPAPVAAATFLHYLIM
PLTAWILAMLFRMPPDLSAGMVLVGSVASGTASNVMIYLAKGDVALSVTISAVSTLVGVFATPLLTRLYVDATISVDVVG
MLKSILQIVVIPITAGLVIHHTFTKTVKRIEPYLPAMSMVCILAIISAVVAGSQSHIASVGFVVIIAVILHNGIGLLSGY
WGGKLFGFDESTCRTLAIAVGMQNSGLAATLGKIYFSPLAALPGALFSVWHNLSGSLLAGYWSGKPVKKDQE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSPORTER, SODIUM/BILE ACID SYMPORTER FAMILY
member of: PANTHER:searchPTHR10361PFAM:searchPF01758UniProt:searchC4ST46
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..RAHHHMLVKITRLFPVWALLLSVAAYFRPTTFTGIGPYVGPLLMLIMFAMGVTLRLDDFKRVLSRPAPVAAATFLHYLIMPLTAWILAMLFRMPPDLSAGMVLVGSVASGTASNVMIYLAKGDVALSVTISAVSTLVGVFATPLLTRLYVDATISVDVVGMLKSILQIVVIPITAGLVIHHTFTKTVKRIEPYLPAMSMVCILAIISAVVAGSQSHIASVGFVVIIAVILHNGIGLLSGYWGGKLFGFDESTCRTLAIAVGMQNSGLAATLGKIYFSPLAALPGALFSVWHNLSGSLLAGYWSGKP
seq num:  ..-4        6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                                  |  |            | |||    |   |                       || |||        | ||||  |         | |        |   |      |   |   | |       |   ||    |   |     |   | | |                    |   |   |  |             ||  | |     | ||  |||      |    |   |      | || | |    || ^***|   | || | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                                  |  |            | ^**    |   |                       || |||        | ||||  |         | |        |   |      |   |   | |       |   ||    |   |     |   | ^**                    |   |   |  |             ||  | |     | ||  ^**      |    |   |      | || | |    || | |||   | |^** 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                                  |  |            |  |     |   |                       || |||        | |^*****         | |        |   |      |   |   | |       ^*****    |   |     |   |                        |   |   |  |             |^*****     | ||   |       ^*****   |      | || | ^*****| | |^***** |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                                  |  |            |  |     |   |                       || |||        | | ||            | |        |   |      |   |   | |       |   |     |   |     |   |                        |   |   |  |             |   |       | |*****            |   |      | || |       | | | |     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                  ****            ****     |   |                       |****|        | | ||            | |        |   |      |   |   | |       |   |     |   |     |   |                        |   |   |  |             |   |       | |                 |   |      ******       | | | |     **** 
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  |  |     |   |                       |  ***        | | ||            ***        |   |      |   |   ***       |   |     |   |     |   |                        |   |   |  |             |   |       ***                 |   |                   | | | |     |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ****     |   |                       |    |        | ****                       |   |      |   |             |   |     |   |     |   |                        |   |   ****             |   |                           |   |                   | | | |     **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                           |   |                       ******        |   |                        |   |      |   |             |   |     |   |     |   |                        |   |                    |   |                           |   |                   | | | |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                           *****                                     *****                        *****      *****             *****     *****     *****                        *****                    *****                           *****                   *******          

   New search    4n7x:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors