triangle PDBeMotif: 4mt5  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Thu, Sep 19, 2013
Title crystal structure of mub-rv
Authors A.M.HEMMINGS, N.JUGE, S.ETZOLD
Method X-RAY DIFFRACTION (resolution: 2.60Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MQTAYVKYVDDTTGETLRQDDLHGYTDETIPYSTAEGIKKYEGDGYVLVSDGFKPGTKFGVGTPTYEVHFKHGMTHTDAT
DKNAEQKTVTETIHYVDENNQTVQPDSTTAVTFKRGYTTDNVTGKVVSYDPWTVDGNQADSKTFAAVPSPAVEGYTPNHQ
QINEFTVTPDSKDIVKTVVYVGDP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MUCUS BINDING PROTEINN
member of: PFAM:searchPF06458UniProt:searchF8KCE4
sec str:  ...eeeeeeeee.....eeeeeeeee.........hhhhhhhhhh..eeeeee.............eeeeeeee.eeee.......eeeeeeeeeeee.......eeeeeeeeeeee.eeee.....eeee...ee..ee...eee..ee......eee...ee..eee......eeeeeeeee..
sequence :  ..MQTAYVKYVDDTTGETLRQDDLHGYTDETIPYSTAEGIKKYEGDGYVLVSDGFKPGTKFGVGTPTYEVHFKHGMTHTDATDKNAEQKTVTETIHYVDENNQTVQPDSTTAVTFKRGYTTDNVTGKVVSYDPWTVDGNQADSKTFAAVPSPAVEGYTPNHQQINEFTVTPDSKDIVKTVVYVGDP
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           || || |      |  | | || ||  | || |||    | || ||   |           | |  | |||||  ||  |   |   |^***        | |     |^***|                          |  |            | ||             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           || |^**      |  | | || ||  | || |||    | || ||   |           | |  | ^**||  ||  |   |   | |          ^**     | |^**                          |  |            | ||             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           ^***  |      |  | | |^***  | || |||    | || ||   |           | ^***  | ||  |^***   |   | |                  | || |                          |  |            | ||             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..            | |  *******^  | | || |   *******^    | || ||   |           |    |  | ||  ********^   | |                  | || |                          |  |            | ||             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | |         |  | | || |     || |||    | || ^*****           ^*****  | ||              | |                  | || |                          |  |            | ||             
search RasMol script viewer Motif-ligand binding stats  asxturn ..            | |         |  | | || |     || |||    | ||  |                    |  ***|              | |                  ***| |                          |  |            | ||             
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |         **** | || |     *****|    | |****                    |  |  |              | |                     | |                          ****            | ||             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            | |         |  | ***| |     |  | |    | ||  |                    |  |  |              | |                     | |                          |  |            | ||             
search RasMol script viewer Motif-ligand binding stats  nest ..            ***         |  |    | |     |  ***    | ||  |                    |  |  |              ***                     ***                          |  |            | ||             
search RasMol script viewer Motif-ligand binding stats  niche ..            | |         ****    | |     |    |    *******                    *******                                      | |                          ****            ****             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..            | |                 | |     ******                                                                            | |                                          | |              
search RasMol script viewer Motif-ligand binding stats  stturn ..            ***                 ***                                                                                       ***                                          ***              

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : MUCUS BINDING PROTEINN
member of: PFAM:searchPF06458UniProt:searchF8KCE4
sec str:  ...eeeeeeeee.....eeeeeeeee.........hhhhhhhhhh..eeeeee.............eeeeeeee.eeee.......eeeeeeeeeeeee....eeeeeeeeeeeeee.eeee.....eeee...ee.......eee..ee......eee...ee..eee......eeeeeeeee..
sequence :  ..MQTAYVKYVDDTTGETLRQDDLHGYTDETIPYSTAEGIKKYEGDGYVLVSDGFKPGTKFGVGTPTYEVHFKHGMTHTDATDKNAEQKTVTETIHYVDENNQTVQPDSTTAVTFKRGYTTDNVTGKVVSYDPWTVDGNQADSKTFAAVPSPAVEGYTPNHQQINEFTVTPDSKDIVKTVVYVGDP
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | || ||||      |  |    | ||  |      |    | || ||   |           | |  | ||| |  ||  |   |   |^***        | |     |^***|                          |  |            |  |             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | || |^**      |  |    | ||  |      |    | || ||   |           | |  | ^** |  ||  |   |   | |          ^**     | |^**                          |  |            |  |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         | ^*** ||      |  |    ^***  |      |    | || ||   |           | ^***  |  |  |^***   |   | |                  | || |                          |  |            |  |             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | || | |*******^  |    | |   *******^    | || ||   |           |    |  |  |  ********^   | |                  | || |                          |  |            |  |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | || | ||      |  |    | |               | || ^*****           ^*****  |  |              | |                  | || |                          |  |            |  |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..         ***| | ||      |  |    | |               ***|  |                    |  |  |              | |                  ***| |                          |  |            |  |             
search RasMol script viewer Motif-ligand binding stats  betabulge ..         |  | | **      |  |    | |               | ||  |                    |  |  |              | |                     | |                          |  |            |  |             
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         ******         |  |    | |               | ||  |                    |  |  |              | |                     | |                          |  |            |  |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |         |  |    | |               | |****                    |  |  |              | |                     | |                          ****            ****             
search RasMol script viewer Motif-ligand binding stats  nest ..            ***         |  |    | |               | ||  |                    |  |  |              ***                     ***                          |  |            |  |             
search RasMol script viewer Motif-ligand binding stats  niche ..                        ****    | |               *******                    *******                                      | |                          ****            ****             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                ***                                                                                       ***                                                           

   New search    4mt5:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors