triangle PDBeMotif: 4lt6  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.7.19
Classification transferase    | release date: Tue, Jul 23, 2013
Title crystal structure of human poly(a) polymerase gamma
Authors G.MARTIN, L.NAUSCH, Q.YANG, S.DOUBLIE, W.KELLER
Method X-RAY DIFFRACTION (resolution: 2.79Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA   search 3AT 3AT binding statistics 3AT
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
HHHHHHMKEMSANTVLDSQRQQKHYGITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEW
ISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVP
VIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRG
IYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEWPNPVLLKQPEESNLNLPVWDPRVNPSDRYHLMPI
ITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVE
SKIRVLVGNLERNEFITLAHVNPQSFPGNKEHHKDNNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNIN
MLKEGMKIEATHVKKKQLHHYLPAEILQKKKKQS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLY(A) POLYMERASE GAMMA
member of: GENE3D:searchG3DSA_1.10.1410.10/searchG3DSA_3.30.70.590PANTHER:searchPTHR10682/searchPTHR10682_SF6PFAM:searchPF01909/searchPF04926/searchPF04928SUPERFAMILY:searchSSF55003/searchSSF81301/searchSSF81631UniProt:searchQ9BWT3
JMol viewer RasMol script viewer  CA 602A  ..                                                                                               * *                                                                                                                                                                                                                                                                                                                    ..CA ..             ..                                                
JMol viewer RasMol script viewer  3AT 601A  ..                                                                                  ***          * *                                                                                      *   *                     *        *         *                                                                             *                                                                                                  ..3AT ..             ..                                                
sec str:  ................hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh....eeeeehhhhhh.......eeeeeee....hhhhhhhhhhhhhhhh..eeeeeee......eeeeee..eeeeeeeee.............hhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh...........................hhhhh..................hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhh.........eeeeeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeeee..... ...eeeeeeeeeee....hhhhhhhhhhhhhhhhhhh.......eeeeeeee..hhhhh......
sequence :  ..KHYGITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEWPNPVLLKQPEESNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRVLVGNLERNEFITLAHVNPQSFPG... ..NYVSMWFLGIIFR..DLTYDIQSFTDTVYRQANNINMLKEGMKIEATHVKKKQLHHYLPAEIL
seq num:  ..17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417   ... ..431          ..454       464       474       484       494     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | || |||  ||| |       ||||                         |   || || ||| ||        ||||||||  |        |  ||  |   |  |||  || |  |  |  |        |  |            | ||| |  | |  |  | |||    |    | || || | || | | |  |  || ||||  || |  |    ||   |   |  |         |  || ||              | |   | |   ||| |     | |    ^***^***| |         |   || | ||||  || || | |              || | |    | |  || |    |  | ||     | |    ..PS00001..             ..     | |||||     | |||||  |        |  || |||||||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         | || |||  ||| |       ||||                         |   || || ||| ||        ||||||||  |        |  ||  |   |  |||  || |  |  |  |        |  |            | ||| |  | |  |  | |||    |    | || || | || | | |  |  || ||||  || |  |    ||   |   |  |         |  || ||              | |   | |   ||| |     | |      |  |  | |         |   || | ||||  || || | |              || | |    | |  || |    |  | ||     | |    ..PS00004..             ..     | |||||     | |||||  |        |  || |||||||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | |^**||  ||^**       ||||                         |   || || ||| ||        ^**|||||  |        |  ||  |   |  |||  || |  |  |  |        |  |            | ||| |  | |  |  | |||    |    | || || | |^** ^**  |  || ||||  || |  |    ||   |   |  |         |  || ||              | |   | |   ^** |     | |      |  |  ^**         |   || | ||||  || || | |              || | |    | |  || |    |  | ||     | |    ..PS00005..             ..     | |||||     | |||||  |        |  || |||||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         | |^***|  ||          ||||                         |   || || ||| ||         | |||||  |        |  ||  |   ^***||  || |  |  |  |        |  |            ^***| |  | |  |  | |||    |    | || || | |         |  || ||||  || |  |    ||   |   |  |         |  |^***              | |   | |    |  |     | |      |  |              |   || | ||||  || || | |              ^*** |    | |  || |    |  | ||     | |    ..PS00006..             ..     | ^***|     | |||||  |        |  || |||||||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | |  ******^          ||||                         |   || || ||| ||         | |||||  |        |  ||  |   |  |||  || |  |  |  |        |  |              | | |  | |  |  | |||    |    | || || | |         |  || ||||  || |  |    ||   |   |  |         |  || |               | |   | |    |  |     | |      |  |              |   || | ||||  || || | |               |   |    | |  || |    |  | ||     | |    ..PS00007..             ..     | ||| |     | |||||  |        |  || |||||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | |    |  ||          ||||                         |   || || ||| ||         | |||||  |        |  ||  |   |  |||  || |  |  |  |        |  |              | | |  | |  |  | |||    ^***** || || | |         |  || |^*****| |  ^*****|   |   |  |         |  || |               | |   | |    |  |     | |      |  |              ^***** | ||||  || || | |               |   |    ^*****| |    |  | ||     | |    ..PS00008..             ..     | ||| |     | |||||  |        |  || |||||||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | |    *****          ||||                         |   || |***** ||         | |||||  |        |  ||  |   *****|  || |  |  |  |        |  |              | | |  | |  |  *****           || || | |         |  || ||||   | |        |   |   |  |         |  || |               | |   | |    |  |     | |      |  |              |   |  | ||||  ***** | |               |   |      ***** |    |  | ||     | |    ..alphabetamotif..             ..     ***** |     | |||||  |        |  *****|||||
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         | |    |  |           ||||                         |   || || ||| ||         | |||||  |        |  ||  |   |  | |  || |  |  |  |        |  |              | | |  | |  |  *****           || || | |         |  || ||||   | |        |   |   |  |         |  || |               | |   | |    |  |     | |      |  |              |   |  | ||||  || || | |               |   |      |  |  |    |  | ||     | |    ..asxmotif..             ..     | ||  |     | |||||  |        |  || |||||||
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | |    |  |           ||||                         |   || || ||| ||         | |||||  |        |  ||  |   |  | |  || |  |  |  |        |  |              | | |  ***  |  ***|            || || ***         |  || ||||   | |        |   |   |  |         |  || |               | |   ***    |  |     | |      |  |              |   |  | ||||  || || | |               |   |      |  |  |    |  ***|     | |    ..asxturn..             ..     | ||  |     | |||||  |        |  || |||||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |    ****           ||||                         |   || |****| ||         ****|||  |        ********   **** |  || |  |  |  |        ****              | | |  | |  |  ****            ****|             |  |****||   | |        |   |   |  |         |  || |               | |          |  |     | |      |  |              |   |  ****||  ****| | |               |   |      *******    |  |  |     | |    ..betaturn..             ..     ****  |     ****||****        *******||||||
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |                   ||||                         |   || |  | | ||           |||||  |                        |  || |  |  |  |                          | | |  | |  |                   |  |             |  |  ||||   | |        |   |   |  |         |  || |               | |          |  |     | |      |  |              |   |    ||||   |  | ***               |   |                 |  |  |     | |    ..gammaturn..             ..       |   |       |||||  |            |  |*****
search RasMol script viewer Motif-ligand binding stats  nest ..         | |                   ****                         |   |***  | | ||           ****|  |                        |  || |  |  |  |                          | | |  | |  |                   |  |             |  |  ****   ***        |   |   |  |         |  || |               ***          |  |     | |      |  |              |   |    ****   |  |                   |   |                 |  |  |     | |    ..nest..             ..       |   |       ****|  |            |  | *** 
search RasMol script viewer Motif-ligand binding stats  niche ..         ***                    ***                         |   |     | ****               ****                        **********  ****                          | | **** ****                   ****             |  |   ***              |   |   ****         |  ****                            ****     ***      ****              |   |           ****                   |   |                 *******     ***    ..niche..             ..       |   |        *******            ****     
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..         | |                                                |   |     |   |                                                                                      | |                                              |  ******               |   |                |   |                                                                  |   |                                  |   |                                    ..schellmannloop..             ..       |   |                                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..         | |                                                |   |     |   |                                                                                      | |                                              |                       |   |                |   |                                                                  |   |                                  *****                                    ..stmotif..             ..       |   |                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..         | |                                                *****     *****                                                                                      | |                                              |                       *****                *****                                                                  *****                                                                           ..ststaple..             ..       *****                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..         ***                                                                                                                                                     ***                                              |                                                                                                                                                                                                   ..stturn..             ..                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                  *                                                                                                                                                                                                   ..REP00000..             ..                                                

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : POLY(A) POLYMERASE GAMMA
member of: GENE3D:searchG3DSA_1.10.1410.10/searchG3DSA_3.30.70.590PANTHER:searchPTHR10682/searchPTHR10682_SF6PFAM:searchPF01909/searchPF04926/searchPF04928SUPERFAMILY:searchSSF55003/searchSSF81301/searchSSF81631UniProt:searchQ9BWT3
JMol viewer RasMol script viewer  CA 602B  ..                                                                                              * *                                                                                                                                                                                                                                                                                                                    ..CA ..             ..                                            
JMol viewer RasMol script viewer  3AT 601B  ..                                                                                 ***          | *                                                                                      *   *                     *        *         *                                                                     *       *                                                                                                  ..3AT ..             ..                                            
sec str:  ...............hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........eeeeehhhhhh.......eeeeeee....hhhhhhh.hhhhhhh.......eee......eeeeee..eeeeeeeee.............hhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh...........................hhhhhhh..................hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh...hhhhh..eeeeeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.......... ...eeeeeeeeeee....hhhhhhhhhhhhhhhhhhh.......eeeeeeee.hhhhhh..
sequence :  ..HYGITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEWPNPVLLKQPEESNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRVLVGNLERNEFITLAHVNPQSFPG... ..NYVSMWFLGIIFR..DLTYDIQSFTDTVYRQANNINMLKEGMKIEATHVKKKQLHHYLP
seq num:  ..18        28        38        48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418  ... ..431          ..454       464       474       484       494 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        | || ||    || |    |  ||||                      |  || | |||| ||| ||        ||||||||  |              || |||| |||  || | | |             |  |        | | |  |  |  | | || |         |    |  |  | | || | | |  |  || ||||  || |  |    ||   |   |  |            || ||            | | |    |  | ||| |     | |    ^***^***| |         |    ||  |||||  |  |                  || |      ||  ||       |  | ||     | |    ..PS00001..             ..       |  |      | |||||          |  ||  || 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        | || ||    || |    |  ||||                      |  || | |||| ||| ||        ||||||||  |              || |||| |||  || | | |             |  |        | | |  |  |  | | || |         |    |  |  | | || | | |  |  || ||||  || |  |    ||   |   |  |            || ||            | | |    |  | ||| |     | |      |  || | |         |    ||  |||||  |  |                  || |      ||  ||       |  | ||     | |    ..PS00004..             ..       |  |      | |||||          |  ||  || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        | |^**|    |^**    |  ||||                      |  || | |||| ||| ||        ^**|||||  |              || |||| |||  || | | |             |  |        | | |  |  |  | | || |         |    |  |  | | |^** ^**  |  || ||||  || |  |    ||   |   |  |            || ||            | | |    |  | ^** |     | |      |  || ^**         |    ||  |||||  |  |                  || |      ||  ||       |  | ||     | |    ..PS00005..             ..       |  |      | |||||          |  ||  || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |^***    |       |  ||||                      |  || | |||| ||| ||         | |||||  |              || ||^***||  || | | |             |  |        | | ^***  |  | | || |         |    |  |  | | |         |  || ||||  || |  |    ||   |   |  |            |^***            | | |    |  |  |  |     | |      |  || |           |    ||  |||||  |  |                  ^***      ||  ||       |  | ||     | |    ..PS00006..             ..       ^***      | |||||          |  ||  || 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        | |  ******^       |  ||||                      |  || | |||| ||| ||         | |||||  |              || ||||  ||  || | | |             |  |        | |       |  | | || |         |    |  |  | | |         |  || ||||  || |  |    ||   |   |  |            |  |             | | |    |  |  |  |     | |      |  || |           |    ||  |||||  |  |                   | |      ||  ||       |  | ||     | |    ..PS00007..             ..                 | |||||          |  ||  || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | |                |  ||||                      |  || | |||| ||| ||         | |||||  |              || ||||  ||  || | | |             |  |        | |       |  | | || |         ^*****  |  | | |         |  || |^*****| |  ^*****|   |   |  |            |  |             | | |    |  |  |  |     | |      |  || |           ^*****|  |||||  |  |                   | |      ^*****       |  | ||     | |    ..PS00008..             ..                 | |||||          |  ||  || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |                |  ||||                      ***** | |||| |*****         | |||||  |              *****|*****  || | | |             |  |        | |       |  | | || |                 |  | | |         |  || ||||   | |        |   |   |  |            |  |             | | |    |  |  |  |     | |      |  || |                 |  |||||  |  |                   | |       |  |        |  | ||     | |    ..alphabetamotif..             ..                 | |||||          |  |***** 
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |                |  ||||                      |  |  | |||| ||| ||         | |||||  |              || | ||  ||  || | | |             |  |        | |       |  | | || |                 |  | ***         |  || ||||   | |        |   |   |  |            |  |             | | |    |  |  |  |     | |      |  || |                 |  |||||  |  |                   | |       |  |        |  ***|     ***    ..asxturn..             ..                 | |||||          |  ||  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |                ****|||                      ****  ****|| |****|         ****|||  |              **** |****|  || | | |             ****        | |       |  | | ****                 |  |             |  |****||   | |        |   |   |  |            |  |             | | |    |  |  |  |     | |      |  || |                 ****|||****  |                   | |       ****        |  |  |     | |    ..betaturn..             ..                 ****|||          ********  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |                   ||||                              | |*** |  |           |||||  |               |   |    |  || | ***                         ***       |  | | || |                 |  |             |  |  ||||   | |        |   |   |  |            |  |             | | |    |  |  |  |     | |      |  || |                    ||||   |  |                   | |                   |  |  |     | |    ..gammaturn..             ..                   ||***                    
search RasMol script viewer Motif-ligand binding stats  nest ..        | |                   ****                              ***    |  |           ****|  |               |   |    |  || |                                       |  | | || |                 |  |             |  |  ****   ***        |   |   |  |            |  |             | ***    |  |  |  |     | |      |  || |                    ****   |  |                   | |                   |  |  |     | |    ..nest..             ..                   ****                     
search RasMol script viewer Motif-ligand binding stats  niche ..        ***                                                            ****               ****               |   |    *******                                       **** ******                 ****             |  |    |               |   |   ****            ****             | |      ****  ****     ***      ****| |                           ****                   | |                   *******     ***    ..niche..             ..                                            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..        | |                                                                                                  |   |                                                                                               |  ******               |   |                                    | |                                  | |                                                  | |                                      ..schellmannloop..             ..                                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..        | |                                                                                                  *****                                                                                               |                       *****                                    | |                                  | |                                                  | |                                      ..ststaple..             ..                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..        ***                                                                                                                                                                                                      |                                                                ***                                  ***                                                  ***                                      ..stturn..             ..                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                 *                                                                                                                                                                                                   ..REP00000..             ..                                            

   New search    4lt6:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors