triangle PDBeMotif: 4lgd  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.11.1
Classification signaling protein    | release date: Thu, Jun 27, 2013
Title structural basis for autoactivation of human mst2 kinase and regulation by rassf5
Authors D.R.TOMCHICK, L.NI, X.LUO
Method X-RAY DIFFRACTION (resolution: 3.05Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search SO4 SO4 binding statistics SO4   search ANP ANP binding statistics ANP   search NA NA binding statistics NA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
MHHHHHHGSSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS
PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGH
AKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPP
TFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEENWKVPQ
DGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQNF
Chains E,F,G,H sequence:
GEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SERINE/THREONINE-PROTEIN KINASE 3
member of: GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24361/searchPTHR24361_SF247PFAM:searchPF00069PROSITE PATTERNS:searchPS00107, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ13188
JMol viewer RasMol script viewer  SO4 503A  ..                                                                                                                                 *                      **                           **                                                                                                                   ..SO4 ..                                                    
JMol viewer RasMol script viewer  MG 502A  ..                                                                                                                                 |                  *   ||                           ||                                                                                                                   ..MG ..                                                    
JMol viewer RasMol script viewer  ANP 501A  ..                 * **    *            * *                                          ****      *                                   |                  *   ||                           ||                                                                                                                   ..ANP ..                                                    
sec str:  ..hhhhhhhhhh.eeeeeeeee....eeeeeee.....eeeeeeee...hhhhhhhhhhhhhh........eeeeeee..eeeeeee....eehhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.............hhhhhh.......hhhhhhhh..hhhhhhhhhhhhhhhhhhh.......hhhhhhhhh.........hhhhhhhhhhhhhhhhh........hhhhhh.hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh...... .........hhhhhhhhhhh.hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..EDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEE... ..FDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQ
seq num:  ..16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306     ... ..437       447       457       467       477         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |  |  |    ||  | |  |       |||   ||  |  || ||  |    |  | |  |                       |  ||||||^*** || ||| |||| ||||  | ||| | | || ||  | |||       | |||     | ||  |||  |      | | |  | | ||| || |||| |  | || || ||||  ||   | | |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00001..  || ^*** |        |  ||          ||| |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |  |  |  |    ||  | |  |       |||   ||  |  || ||  |    |  | |  |                       |  |||||||||  || ||| |||| ||||  | ||| | | || ||  | |||       | |||     **^*  |||  |      | | |  | | ||| || |||| |  | || || ||||  ||   | | |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00004..  || |||  |        |  ||          ||| |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |  |  |    ||  | |  |       |||   ||  |  || ||  |    |  | |  |                       |  |||||||||  || ||| |||^**|||  | ||| | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| || |||| |  | || || ||||  ||   ^** |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00005..  || |||  |        |  ||          ^** |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |  |  |    ||  | |  |       |||   ||  |  || ||  |    |  | |  |                       ^***|||||||^***| ||| ||||  |||  | ||| | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ^***||| |  | || || ||||  ||       |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00006..  || ||^***        |  ||           |  |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  |  |  |    ******^  |       |||   ||  |  || ||  |    |  | |  |                          ||||||||   || ||| ||||  |||  | ||| | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| || |||| |  | || || ||||  ||       |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00007..  || ||            |  ||           |  |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |  |  |     |  ^*****       |^*****|  |  || ||  |    |  | |  |                          ||||||||   || ||| ||||  |||  | ||| | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| || |||| |  | || || ||||  ||       |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00008..  || ||            |  ||           |  |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..  |  |  |  |     ************************  |  || ||  |    |  | |  |                          ||||||||   || ||| ||||  |||  | ||| | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| || |||| |  | || || ||||  ||       |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00107..  || ||            |  ||           |  |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |  |  |                     | |       |  || ||  |    |  | |  |                          *****|||   ***************|  | ||| | | || ||  | |||       | |||        |  |||  |      | | |  | ************| |  | || ***********       |  |            | ||  |  ***** |  |  |      || |||***** | ******      ..alphabetamotif..  || ||            *****           |  ************* 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |  |  |                     | |       |  || |****    |  | |  |                          *******|   ************** *******| | | || ||  ****|       ****|        ****||  |      | | **** *********** | |  | || ***** ****        |  |            | ||  |  ****  |  |  |      ************* *****       ..betaturn..  ****|            ****            ***************  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |  |  |                     ***       |  |***        |  | |  |                            |  ***                       *** *** || ||    ***         ***            ||  |      ***    |   |         ***  ***|                   |  |            | ||  |     |  |  |  |                                ..nest..   |  |                                             
search RasMol script viewer Motif-ligand binding stats  niche ..  ****  ****                               ****           **** ****                            |    |                             | |****                               |****             |   |              ****                   ****            *******     ****  ****                                ..niche..   ****                                             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                               ******                             | |  |                                |                 |   |                                                                                                           ..schellmannloop..                                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                  | |  |                                |                 *****                                                                                                           ..ststaple..                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                  * *  *                                *                                                                                                                                 ..REP00000..                                                    

chain E : RAS ASSOCIATION DOMAIN FAMILY MEMBER 5, RASSF5
member of: PANTHER:searchPTHR22738/searchPTHR22738_SF9PROSITE PROFILES:searchPS50951, UniProt:searchQ8WWW0
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..VEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
seq num:  ..367       377       387       397       407    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. || ||^*** ||||^***|||       |  |   |  | || |||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. || ||  **************       |  |   |  | |*****
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|  ***** ********       ****   **** ***** 
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                                         

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : SERINE/THREONINE-PROTEIN KINASE 3
member of: GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24361/searchPTHR24361_SF247PFAM:searchPF00069PROSITE PATTERNS:searchPS00107, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ13188
JMol viewer RasMol script viewer  NA 505C  ..                     ..                                                  *                                                                                                                                                                                                                               ..NA ..                                                      
JMol viewer RasMol script viewer  NA 504C  ..                     ..                                                  |                              *                                                                                                                                                                                                ..NA ..                                                      
JMol viewer RasMol script viewer  SO4 503C  ..                     ..                                                  |                              |                       *                      **                           **                                                                                                                   ..SO4 ..                                                      
JMol viewer RasMol script viewer  MG 502C  ..                     ..                                                  |                              |                       |                  *   ||                           ||                                                                                                                   ..MG ..                                                      
JMol viewer RasMol script viewer  ANP 501C  ..                     .. *            * *                                 |         * *      *           |                       |                  *   ||                           ||                                                                                                                   ..ANP ..                                                      
sec str:  ............hhhh.eee......eeeeee.....eeeeeeee...hhhhhhhhhhhhhh........eeeeeee..eeeeeee....eehhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.............hhhhhh.......hhhhhhhh....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh......hhhhhhhhhhhhhhhhh..hhhhh.hhhhhh.hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... .........hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..KKLSEDSLTKQPEEVFDVLEK..SVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEE... ..FDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQN
seq num:  ..12        22         ..40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310 ... ..437       447       457       467       477       487 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| ||| || |  |  |    |.. |       |||   ||  |  || || ||||  |  | |  |                       |  ||  ||^*** ||  || || | ||| |  || | | | || ||    | |       | |||     | ||  |||  |      | |    | | ||| || |||     | ||               | | |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00001..  || ^*** |        |  || ||  |  | | |     |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..**^*| || |  |  |    |.. |       |||   ||  |  || || ||||  |  | |  |                       |  ||  || ||  ||  || || | ||| |  || | | | || ||    | |       | |||     **^*  |||  |      | |    | | ||| || |||     | ||               | | |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00004..  || |||  |        |  || ||  |  | | |     |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | || |  |  |    |.. |       |||   ||  |  || || ||||  |  | |  |                       |  ||  || ||  ||  || || ^**|| |  || | | | || ||    | |       | |||        |  |||  |      | |    | | ||| || |||     | ||               ^** |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00005..  || |||  |        |  || ||  |  | ^**     |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | || |  |  |    |.. |       |||   ||  |  || || ||||  |  | |  |                       ^***|  || |^***|  || || |  || |  || | | | || ||    | |       | |||        |  |||  |      | |    | | ||| ^***||     | ||                   |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00006..  || ||^***        |  || ||  |  |         |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    | || |  |  |    *.. |       |||   ||  |  || || ||||  |  | |  |                           |  || |    |  || || |  || |  || | | | || ||    | |       | |||        |  |||  |      | |    | | ||| || |||     | ||                   |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00007..  || ||            |  || ||  |  |         |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | || |  |  |     ..**       |^*****|  |  || || ||||  |  | |  |                           |  || |    |  || || |  || |  || | | | || ||    | |       | |||        |  |||  |      | |    | | ||| || |||     | ||                   |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00008..  || ||            |  || ||  |  |         |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..    | || |  |  |     ..*****************  |  || || ||||  |  | |  |                           |  || |    |  || || |  || |  || | | | || ||    | |       | |||        |  |||  |      | |    | | ||| || |||     | ||                   |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00107..  || ||            |  || ||  |  |         |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | || |  |  |     ..         | |       |  || |*****|  |  | |  |                           |  || |    ***** || ***** ***** | | | || ||    | |       | |||        |  |||  |      | |    | ***** |*****     | ||                   |  |   |  ***** | ||  |   | || |  |  |          ||*****||             ..alphabetamotif..  || ||            ********  |  |         *********   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    **** |  |  |     ..         | |       |  || |******  |  | |  |                           ****| |    ******** ****  ****| | | | || ||    | |       ****|        ****||  |      | |    | ***********      ****                   |  |   *******  | ||  |   **** |  ****          *********             ..betaturn..  ****|            *******   ****         ********    
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |  |  |     ..         ***       |  |***        |  | |  |                               ***                       *** *** || ||    ***         ***            ||  |      ***    |   |              ***|                   |  |            | ||  |     |  |  |  |                                ..nest..   |  |                                               
search RasMol script viewer Motif-ligand binding stats  niche ..      ****  ****     ..                   ****           **** ****                                                               | |****                               |****             |   |              ****                   ****            *******     ****  ****                                ..niche..   ****                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     ..                                                                                                          | |  |                                |                 *****                                                                                                           ..ststaple..                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                     ..                                                                                                          * *  *                                *                                                                                                                                 ..REP00000..                                                      

chain G : RAS ASSOCIATION DOMAIN FAMILY MEMBER 5, RASSF5
member of: PANTHER:searchPTHR22738/searchPTHR22738_SF9PROSITE PROFILES:searchPS50951, UniProt:searchQ8WWW0
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..EVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
seq num:  ..366       376       386       396       406     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |^*** ||  ^*** ||||||  || ||   |  || |||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |  *****  | ********|  || ||   *********  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |  ******** *********  *****   ********   
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                                         

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : SERINE/THREONINE-PROTEIN KINASE 3
member of: GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24361/searchPTHR24361_SF247PFAM:searchPF00069PROSITE PATTERNS:searchPS00107, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ13188
JMol viewer RasMol script viewer  NA 506D  ..                                                                                                              *                                                                                                                                                                                                ..NA ..                                   
JMol viewer RasMol script viewer  SO4 505D  ..        **                                                                     *                              |                                                                                                                                                                                                ..SO4 ..                                   
JMol viewer RasMol script viewer  SO4 504D  ..   **  *||                         *                                           |                              |                                                                                                                                                                                                ..SO4 ..                                   
JMol viewer RasMol script viewer  SO4 503D  ..   ||  |||                         |                                           |                              |                       *                      **                            *                                                                                                                   ..SO4 ..                                   
JMol viewer RasMol script viewer  MG 502D  ..   ||  |||                         |                                           |                              |                       |                  *   ||                            |                                                                                                                   ..MG ..                                   
JMol viewer RasMol script viewer  ANP 501D  ..   ||  |||              ***   *    |       * *                                 |         * *      *           |                       |       *          *   ||                            |                                                                                                                   ..ANP ..                                   
sec str:  ......hhhhhhhhhhhheeeeeeeee....eeeeeee.....eeeeeeee...hhhhhhhhhhhhhh........eeeeeee..eeeeeee....eehhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee............hhhhhhh.......hhhhhhh.....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh......hhhhhhhhhhhhhhhhh........hhhhhh.hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..... ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..LKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEE... ..LDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQ
seq num:  ..11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301          ... ..455       465       475       485  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | ||  || | || ||    ||  | |  |    || |||   ||   | || |  |  || |  | |  |                   |  ||| ||||||^*** ||  || || |||       | | | | || ||  | |||       | |||     | ||  |||  |      | | |  | | ||| ||||||| |  | || || ||||       | | |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00001.. |  ||      |   | |   | || || |||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. **^*  || | || ||    ||  | |  |    || |||   ||   | || |  |  || |  | |  |                   |  ||| |||||| ||  ||  || || |||       | | | | || ||  | |||       | |||     **^*  |||  |      | | |  | | ||| ||||||| |  | || || ||||       | | |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00004.. |  ||      |   | |   | || || |||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  || | || ||    ||  | |  |    || |||   ||   | || |  |  || |  | |  |                   |  ||| |||||| ||  ||  || || ^**       | | | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ||||||| |  | || || ||||       ^** |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00005.. |  ||      |   ^**   | || || |||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |  || | || ||    ||  | |  |    || |||   ||   | || |  |  || |  | |  |                   |  |^***||||| |^***|  || ||  ||       | | | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ^***||| |  | || || ||||           |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00006.. |  ||      |   |     | || || |||  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    |  || | || ||    ******^  |    || |||   ||   | || |  |  || |  | |  |                   |  | | |||||| |    |  || ||  ||       | | | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ||| ||| |  | || || ||||           |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00007.. |  ||      |   |     | || || |||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    |  || | || ||     |  ^*****    || |^*****|   | || |  |  || |  | |  |                   |  | | |||||| |    |  || ||  ||       | | | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ||| ||| |  | || || ||||           |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00008.. |  ||      |   |     | || || |||  
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..    |  || | || ||     ************************   | || |  |  || |  | |  |                   |  | | |||||| |    |  || ||  ||       | | | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ||| ||| |  | || || ||||           |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00107.. |  ||      |   |     | || || |||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    |  || | *****                  || |||        | || |  ***** |  | |  |                   |  | *******| |    |  || |*****       | | | | || ||  | |||       | |||        |  |||  |      | | |  | ************| |  | || ******|           |  |      ***** | ||  |   | || |  |  |  |  | *******************   | |..alphabetamotif.. *****      |   |     | || ******  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    |  || | || ||                  ******        | || |  |  |  |  | |  |                   |  | | || ||| |    |  || ||  |        | | | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ||  | | |  | || || || |           |  |      |  |  | ||  |   | || |  |  |  |  | |  | || ||  ||| ||    | |..betabulgeloop.. |  |       |   |     | || || ||   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |  || | ****|                   ****|        | || |  ****  |  | |  |                   **** *******| |    ***********        | | | | || ||  ****|       ****|        ****||  |      | | **** *********** | |  **** *******           |  |      ****  | |****   **** |  |  |  **** **** *************    | |..betaturn.. ****       |   |     **********   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    |  || |  |  |                     | |        | || |        |  | |  |                               | |                       | | | | || ||    | |         | |            ||  |      | |    |   |         | |  | ||                   |  |            | ||  |     |  |  |  |                             ***..gammaturn..            |   |                  
search RasMol script viewer Motif-ligand binding stats  nest ..    |  || |  |  |                     ***        | |***        |  | |  |                               ***                       *** *** || ||    ***         ***            ||  |      ***    |   |         ***  ***|                   |  |            | ||  |     |  |  |  |                                ..nest..            |   |                  
search RasMol script viewer Motif-ligand binding stats  niche ..    |  ****  ****                                ***           **** ****                                                               | |****                               |****             |   |              ****                   ****            *******     ****  ****                                ..niche..            |   |                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..    *****                                                                                                                              | |  |                                |                 |   |                                                                                                           ..stmotif..            |   |                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                       | |  |                                |                 *****                                                                                                           ..ststaple..            *****                  
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                       * *  *                                *                                                                                                                                 ..REP00000..                                   

chain H : RAS ASSOCIATION DOMAIN FAMILY MEMBER 5, RASSF5
member of: PANTHER:searchPTHR22738/searchPTHR22738_SF9PROSITE PROFILES:searchPS50951, UniProt:searchQ8WWW0
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.
sequence :  ..EVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQK
seq num:  ..366       376       386       396       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |^***|  ||^*** |||  |             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |    *****| *****|  |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |    **** ****** ****             
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                                 

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : SERINE/THREONINE-PROTEIN KINASE 3
member of: GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24361/searchPTHR24361_SF247PFAM:searchPF00069PROSITE PATTERNS:searchPS00107, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ13188
JMol viewer RasMol script viewer  SO4 506B  ..         ***                                                                   **                                                                                                                                                                                                                               ..SO4 ..                                              
JMol viewer RasMol script viewer  SO4 505B  ..         |||                                                                   ||                              *  *                                                                                                                                                        *  **                                ..SO4 ..                                              
JMol viewer RasMol script viewer  SO4 504B  ..    **  *|||                        * *                                        ||                              |  |                                                                                                                                                        |  ||                                ..SO4 ..                                              
JMol viewer RasMol script viewer  SO4 503B  ..    ||  ||||                        | |                                        ||                              |  |                    *                      **                            *                                                                              |  ||                                ..SO4 ..                                              
JMol viewer RasMol script viewer  MG 502B  ..    ||  ||||                        | |                                        ||                              |  |                    |                  *   ||                            |                                                                              |  ||                                ..MG ..                                              
JMol viewer RasMol script viewer  ANP 501B  ..    ||  ||||             ***   *    | |     * *                                ||        ** *      *           |  |                    |       *          *   ||                            |                                                                              |  ||                                ..ANP ..                                              
sec str:  ..............hhhhheeeeeeeee....eeeeeee....eeeeeeeee...hhhhhhhhhhhhhh........eeeeeee..eeeeeee....eehhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee..........................hhhhhhhh....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh......hhhhhhhhhhhhhhhhh........hhhhhh.hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... ...hhhhh......hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..KLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEE... ..LSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQ
seq num:  ..10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310 ... ..443       453       463       473       483   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| | ||  |  | || ||    ||  | |  |    |  |||   ||  | ||| |  |  || |  | |  |        |  |           || ||||||^*** |    |  | |||  || ||| | | | || ||  | |||       | ||||    | ||   ||  |      | |    | | ||| ||||||| |  | || |  ||         | | |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00001..*** |        |  ||          | |               
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| **^*  |  | || ||    ||  | |  |    |  |||   ||  | ||| |  |  || |  | |  |        |  |           || |||||||||  |    |  | |||  || ||| | | | || ||  | |||       | ||||    **^*   ||  |      | |    | | ||| ||||||| |  | || |  ||         | | |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00004.. |  |        |  ||          | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*       |  | || ||    ||  | |  |    |  |||   ||  | ||| |  |  || |  | |  |        |  |           || |||||||||  |    |  | ^**  || ||| | | | || ||  | |||       | ||||           ||  |      | |    | | ||| ||||||| |  | || |  ||         ^** |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00005.. |  |        |  ||          ^**               
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  | || ||    ||  | |  |    |  |||   ||  | ||| |  |  || |  | |  |        |  |           ^***|||||||^***    |  |  ||  || ||| | | | || ||  | |||       | ||||           ||  |      | |    | | ||| ^***||| |  | || |  ||             |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00006.. ^***        |  ||                            
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        |  | || ||    ******^  |    |  |||   ||  | ||| |  |  || |  | |  |        |  |            | ||||||||        |  |  ||  || ||| | | | || ||  | |||       | ||||           ||  |      | |    | | |||  || ||| |  | || |  ||             |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00007..             |  ||                            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        |  | || ||     |  ^*****    |  |^*****|  | ||| |  |  || |  | |  |        |  |            | ||||||||        |  |  ||  || ||| | | | || ||  | |||       | ||||           ||  |      | |    | | |||  || ||| |  | || |  ||             |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00008..             |  ||                            
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..        |  | || ||     ************************  | ||| |  |  || |  | |  |        |  |            | ||||||||        |  |  ||  || ||| | | | || ||  | |||       | ||||           ||  |      | |    | | |||  || ||| |  | || |  ||             |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00107..             |  ||                            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        |  | *****                  |  | |       | ||| |  ***** |  | |  |        |  |            | *****|||        |  ************* | | | || ||  | |||       | ||||           ||  |      | |    | ************| |  | || *****             |  |  ********* | ||  |    || ||  |  |         ********   |*****      ..alphabetamotif..             *****                            
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        |  | || ||                  ******       | ||| |  |  |  |  | |  |        |  |            | ||||||||        |  |  ||  || ||| | | | || ||  | |||       | ||||           ||  |      | |    | | |||  |  | | |  | || |  |              |  |  |  ||  |  | ||  |    || ||  |  |         | ||||||   || ||       ..betabulgeloop..             |  |                             
search RasMol script viewer Motif-ligand binding stats  betaturn ..        |  | ****|                     | |       | ||| |  ****  |  | |  |        ****            *********|        ***************| | | | || ||  ****|       ******           ||  |      | |    | *********** | |  | || ****              |  |  ********  | ||  |    ****|  |  |         ********   *****       ..betaturn..             ****                             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        |  |  |  |                     | |       | *** |        |  | |  |                            |  | |                       | | | | || ||    | |         | |            ||  |      | |    |   |         | |  | ||                   |  |            | ||  |     |  |  |  |                                ..gammaturn..                                              
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |  |  |                     ***       |  |***        |  | |  |                            |  ***                       *** *** || ||    ***         ***            ||  |      ***    |   |         ***  ***|                   |  |            | ||  |     |  |  |  |                                ..nest..                                              
search RasMol script viewer Motif-ligand binding stats  niche ..        ****  ****                               ****           **** ****                            |    |                             | |****                               |****             |   |              ****                   ****            *******     ****  ****                                ..niche..                                              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                     ******                             | |  |                                |                 |   |                                                                                                           ..schellmannloop..                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                        | |  |                                |                 *****                                                                                                           ..ststaple..                                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                        * *  *                                *                                                                                                                                 ..REP00000..                                              

chain F : RAS ASSOCIATION DOMAIN FAMILY MEMBER 5, RASSF5
member of: PANTHER:searchPTHR22738/searchPTHR22738_SF9PROSITE PROFILES:searchPS50951, UniProt:searchQ8WWW0
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..DAFSIPELQNFLTILEKEEQDKIQQVQKK
seq num:  ..370       380       390      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***     ^***|||| || |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            *****||| || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..            *************    

Assembly 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SERINE/THREONINE-PROTEIN KINASE 3
member of: GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24361/searchPTHR24361_SF247PFAM:searchPF00069PROSITE PATTERNS:searchPS00107, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ13188
JMol viewer RasMol script viewer  SO4 503A  ..                                                                                                                                 *                      **                           **                                                                                                                   ..SO4 ..                                                    
JMol viewer RasMol script viewer  MG 502A  ..                                                                                                                                 |                  *   ||                           ||                                                                                                                   ..MG ..                                                    
JMol viewer RasMol script viewer  ANP 501A  ..                 * **    *            * *                                          ****      *                                   |                  *   ||                           ||                                                                                                                   ..ANP ..                                                    
sec str:  ..hhhhhhhhhh.eeeeeeeee....eeeeeee.....eeeeeeee...hhhhhhhhhhhhhh........eeeeeee..eeeeeee....eehhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.............hhhhhh.......hhhhhhhh..hhhhhhhhhhhhhhhhhhh.......hhhhhhhhh.........hhhhhhhhhhhhhhhhh........hhhhhh.hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh...... .........hhhhhhhhhhh.hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..EDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEE... ..FDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQ
seq num:  ..16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306     ... ..437       447       457       467       477         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |  |  |    ||  | |  |       |||   ||  |  || ||  |    |  | |  |                       |  ||||||^*** || ||| |||| ||||  | ||| | | || ||  | |||       | |||     | ||  |||  |      | | |  | | ||| || |||| |  | || || ||||  ||   | | |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00001..  || ^*** |        |  ||          ||| |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |  |  |  |    ||  | |  |       |||   ||  |  || ||  |    |  | |  |                       |  |||||||||  || ||| |||| ||||  | ||| | | || ||  | |||       | |||     **^*  |||  |      | | |  | | ||| || |||| |  | || || ||||  ||   | | |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00004..  || |||  |        |  ||          ||| |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |  |  |    ||  | |  |       |||   ||  |  || ||  |    |  | |  |                       |  |||||||||  || ||| |||^**|||  | ||| | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| || |||| |  | || || ||||  ||   ^** |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00005..  || |||  |        |  ||          ^** |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |  |  |    ||  | |  |       |||   ||  |  || ||  |    |  | |  |                       ^***|||||||^***| ||| ||||  |||  | ||| | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ^***||| |  | || || ||||  ||       |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00006..  || ||^***        |  ||           |  |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  |  |  |    ******^  |       |||   ||  |  || ||  |    |  | |  |                          ||||||||   || ||| ||||  |||  | ||| | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| || |||| |  | || || ||||  ||       |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00007..  || ||            |  ||           |  |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |  |  |     |  ^*****       |^*****|  |  || ||  |    |  | |  |                          ||||||||   || ||| ||||  |||  | ||| | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| || |||| |  | || || ||||  ||       |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00008..  || ||            |  ||           |  |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..  |  |  |  |     ************************  |  || ||  |    |  | |  |                          ||||||||   || ||| ||||  |||  | ||| | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| || |||| |  | || || ||||  ||       |  |            | ||  |  |  || |  |  |      || |||||||| | || |||      ..PS00107..  || ||            |  ||           |  |  ||  || ||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |  |  |                     | |       |  || ||  |    |  | |  |                          *****|||   ***************|  | ||| | | || ||  | |||       | |||        |  |||  |      | | |  | ************| |  | || ***********       |  |            | ||  |  ***** |  |  |      || |||***** | ******      ..alphabetamotif..  || ||            *****           |  ************* 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |  |  |                     | |       |  || |****    |  | |  |                          *******|   ************** *******| | | || ||  ****|       ****|        ****||  |      | | **** *********** | |  | || ***** ****        |  |            | ||  |  ****  |  |  |      ************* *****       ..betaturn..  ****|            ****            ***************  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |  |  |                     ***       |  |***        |  | |  |                            |  ***                       *** *** || ||    ***         ***            ||  |      ***    |   |         ***  ***|                   |  |            | ||  |     |  |  |  |                                ..nest..   |  |                                             
search RasMol script viewer Motif-ligand binding stats  niche ..  ****  ****                               ****           **** ****                            |    |                             | |****                               |****             |   |              ****                   ****            *******     ****  ****                                ..niche..   ****                                             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                               ******                             | |  |                                |                 |   |                                                                                                           ..schellmannloop..                                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                  | |  |                                |                 *****                                                                                                           ..ststaple..                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                  * *  *                                *                                                                                                                                 ..REP00000..                                                    

chain B : SERINE/THREONINE-PROTEIN KINASE 3
member of: GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24361/searchPTHR24361_SF247PFAM:searchPF00069PROSITE PATTERNS:searchPS00107, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ13188
JMol viewer RasMol script viewer  SO4 506B  ..         ***                                                                   **                                                                                                                                                                                                                               ..SO4 ..                                              
JMol viewer RasMol script viewer  SO4 505B  ..         |||                                                                   ||                              *  *                                                                                                                                                        *  **                                ..SO4 ..                                              
JMol viewer RasMol script viewer  SO4 504B  ..    **  *|||                        * *                                        ||                              |  |                                                                                                                                                        |  ||                                ..SO4 ..                                              
JMol viewer RasMol script viewer  SO4 503B  ..    ||  ||||                        | |                                        ||                              |  |                    *                      **                            *                                                                              |  ||                                ..SO4 ..                                              
JMol viewer RasMol script viewer  MG 502B  ..    ||  ||||                        | |                                        ||                              |  |                    |                  *   ||                            |                                                                              |  ||                                ..MG ..                                              
JMol viewer RasMol script viewer  ANP 501B  ..    ||  ||||             ***   *    | |     * *                                ||        ** *      *           |  |                    |       *          *   ||                            |                                                                              |  ||                                ..ANP ..                                              
sec str:  ..............hhhhheeeeeeeee....eeeeeee....eeeeeeeee...hhhhhhhhhhhhhh........eeeeeee..eeeeeee....eehhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee..........................hhhhhhhh....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh......hhhhhhhhhhhhhhhhh........hhhhhh.hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... ...hhhhh......hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..KLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEE... ..LSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQ
seq num:  ..10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310 ... ..443       453       463       473       483   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| | ||  |  | || ||    ||  | |  |    |  |||   ||  | ||| |  |  || |  | |  |        |  |           || ||||||^*** |    |  | |||  || ||| | | | || ||  | |||       | ||||    | ||   ||  |      | |    | | ||| ||||||| |  | || |  ||         | | |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00001..*** |        |  ||          | |               
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| **^*  |  | || ||    ||  | |  |    |  |||   ||  | ||| |  |  || |  | |  |        |  |           || |||||||||  |    |  | |||  || ||| | | | || ||  | |||       | ||||    **^*   ||  |      | |    | | ||| ||||||| |  | || |  ||         | | |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00004.. |  |        |  ||          | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*       |  | || ||    ||  | |  |    |  |||   ||  | ||| |  |  || |  | |  |        |  |           || |||||||||  |    |  | ^**  || ||| | | | || ||  | |||       | ||||           ||  |      | |    | | ||| ||||||| |  | || |  ||         ^** |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00005.. |  |        |  ||          ^**               
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  | || ||    ||  | |  |    |  |||   ||  | ||| |  |  || |  | |  |        |  |           ^***|||||||^***    |  |  ||  || ||| | | | || ||  | |||       | ||||           ||  |      | |    | | ||| ^***||| |  | || |  ||             |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00006.. ^***        |  ||                            
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        |  | || ||    ******^  |    |  |||   ||  | ||| |  |  || |  | |  |        |  |            | ||||||||        |  |  ||  || ||| | | | || ||  | |||       | ||||           ||  |      | |    | | |||  || ||| |  | || |  ||             |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00007..             |  ||                            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        |  | || ||     |  ^*****    |  |^*****|  | ||| |  |  || |  | |  |        |  |            | ||||||||        |  |  ||  || ||| | | | || ||  | |||       | ||||           ||  |      | |    | | |||  || ||| |  | || |  ||             |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00008..             |  ||                            
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..        |  | || ||     ************************  | ||| |  |  || |  | |  |        |  |            | ||||||||        |  |  ||  || ||| | | | || ||  | |||       | ||||           ||  |      | |    | | |||  || ||| |  | || |  ||             |  |  |  ||  || | ||  |    || ||  |  |         | ||||||   || |||      ..PS00107..             |  ||                            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        |  | *****                  |  | |       | ||| |  ***** |  | |  |        |  |            | *****|||        |  ************* | | | || ||  | |||       | ||||           ||  |      | |    | ************| |  | || *****             |  |  ********* | ||  |    || ||  |  |         ********   |*****      ..alphabetamotif..             *****                            
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        |  | || ||                  ******       | ||| |  |  |  |  | |  |        |  |            | ||||||||        |  |  ||  || ||| | | | || ||  | |||       | ||||           ||  |      | |    | | |||  |  | | |  | || |  |              |  |  |  ||  |  | ||  |    || ||  |  |         | ||||||   || ||       ..betabulgeloop..             |  |                             
search RasMol script viewer Motif-ligand binding stats  betaturn ..        |  | ****|                     | |       | ||| |  ****  |  | |  |        ****            *********|        ***************| | | | || ||  ****|       ******           ||  |      | |    | *********** | |  | || ****              |  |  ********  | ||  |    ****|  |  |         ********   *****       ..betaturn..             ****                             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        |  |  |  |                     | |       | *** |        |  | |  |                            |  | |                       | | | | || ||    | |         | |            ||  |      | |    |   |         | |  | ||                   |  |            | ||  |     |  |  |  |                                ..gammaturn..                                              
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |  |  |                     ***       |  |***        |  | |  |                            |  ***                       *** *** || ||    ***         ***            ||  |      ***    |   |         ***  ***|                   |  |            | ||  |     |  |  |  |                                ..nest..                                              
search RasMol script viewer Motif-ligand binding stats  niche ..        ****  ****                               ****           **** ****                            |    |                             | |****                               |****             |   |              ****                   ****            *******     ****  ****                                ..niche..                                              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                     ******                             | |  |                                |                 |   |                                                                                                           ..schellmannloop..                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                        | |  |                                |                 *****                                                                                                           ..ststaple..                                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                        * *  *                                *                                                                                                                                 ..REP00000..                                              

chain E : RAS ASSOCIATION DOMAIN FAMILY MEMBER 5, RASSF5
member of: PANTHER:searchPTHR22738/searchPTHR22738_SF9PROSITE PROFILES:searchPS50951, UniProt:searchQ8WWW0
JMol viewer RasMol script viewer  SO4 506B  ..            *                                  
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..VEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
seq num:  ..367       377       387       397       407    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. || ||^*** ||||^***|||       |  |   |  | || |||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. || ||  **************       |  |   |  | |*****
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|  ***** ********       ****   **** ***** 
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                                         

chain F : RAS ASSOCIATION DOMAIN FAMILY MEMBER 5, RASSF5
member of: PANTHER:searchPTHR22738/searchPTHR22738_SF9PROSITE PROFILES:searchPS50951, UniProt:searchQ8WWW0
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..DAFSIPELQNFLTILEKEEQDKIQQVQKK
seq num:  ..370       380       390      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***     ^***|||| || |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            *****||| || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..            *************    

Assembly 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : SERINE/THREONINE-PROTEIN KINASE 3
member of: GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24361/searchPTHR24361_SF247PFAM:searchPF00069PROSITE PATTERNS:searchPS00107, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ13188
JMol viewer RasMol script viewer  NA 505C  ..                     ..                                                  *                                                                                                                                                                                                                               ..NA ..                                                      
JMol viewer RasMol script viewer  NA 504C  ..                     ..                                                  |                              *                                                                                                                                                                                                ..NA ..                                                      
JMol viewer RasMol script viewer  SO4 503C  ..                     ..                                                  |                              |                       *                      **                           **                                                                                                                   ..SO4 ..                                                      
JMol viewer RasMol script viewer  MG 502C  ..                     ..                                                  |                              |                       |                  *   ||                           ||                                                                                                                   ..MG ..                                                      
JMol viewer RasMol script viewer  ANP 501C  ..                     .. *            * *                                 |         * *      *           |                       |                  *   ||                           ||                                                                                                                   ..ANP ..                                                      
sec str:  ............hhhh.eee......eeeeee.....eeeeeeee...hhhhhhhhhhhhhh........eeeeeee..eeeeeee....eehhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee.............hhhhhh.......hhhhhhhh....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh......hhhhhhhhhhhhhhhhh..hhhhh.hhhhhh.hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... .........hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..KKLSEDSLTKQPEEVFDVLEK..SVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEE... ..FDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQN
seq num:  ..12        22         ..40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310 ... ..437       447       457       467       477       487 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| ||| || |  |  |    |.. |       |||   ||  |  || || ||||  |  | |  |                       |  ||  ||^*** ||  || || | ||| |  || | | | || ||    | |       | |||     | ||  |||  |      | |    | | ||| || |||     | ||               | | |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00001..  || ^*** |        |  || ||  |  | | |     |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..**^*| || |  |  |    |.. |       |||   ||  |  || || ||||  |  | |  |                       |  ||  || ||  ||  || || | ||| |  || | | | || ||    | |       | |||     **^*  |||  |      | |    | | ||| || |||     | ||               | | |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00004..  || |||  |        |  || ||  |  | | |     |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | || |  |  |    |.. |       |||   ||  |  || || ||||  |  | |  |                       |  ||  || ||  ||  || || ^**|| |  || | | | || ||    | |       | |||        |  |||  |      | |    | | ||| || |||     | ||               ^** |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00005..  || |||  |        |  || ||  |  | ^**     |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | || |  |  |    |.. |       |||   ||  |  || || ||||  |  | |  |                       ^***|  || |^***|  || || |  || |  || | | | || ||    | |       | |||        |  |||  |      | |    | | ||| ^***||     | ||                   |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00006..  || ||^***        |  || ||  |  |         |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    | || |  |  |    *.. |       |||   ||  |  || || ||||  |  | |  |                           |  || |    |  || || |  || |  || | | | || ||    | |       | |||        |  |||  |      | |    | | ||| || |||     | ||                   |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00007..  || ||            |  || ||  |  |         |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | || |  |  |     ..**       |^*****|  |  || || ||||  |  | |  |                           |  || |    |  || || |  || |  || | | | || ||    | |       | |||        |  |||  |      | |    | | ||| || |||     | ||                   |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00008..  || ||            |  || ||  |  |         |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..    | || |  |  |     ..*****************  |  || || ||||  |  | |  |                           |  || |    |  || || |  || |  || | | | || ||    | |       | |||        |  |||  |      | |    | | ||| || |||     | ||                   |  |   |  |  || | ||  |   | || |  |  |          |||||||||             ..PS00107..  || ||            |  || ||  |  |         |  ||  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | || |  |  |     ..         | |       |  || |*****|  |  | |  |                           |  || |    ***** || ***** ***** | | | || ||    | |       | |||        |  |||  |      | |    | ***** |*****     | ||                   |  |   |  ***** | ||  |   | || |  |  |          ||*****||             ..alphabetamotif..  || ||            ********  |  |         *********   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    **** |  |  |     ..         | |       |  || |******  |  | |  |                           ****| |    ******** ****  ****| | | | || ||    | |       ****|        ****||  |      | |    | ***********      ****                   |  |   *******  | ||  |   **** |  ****          *********             ..betaturn..  ****|            *******   ****         ********    
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |  |  |     ..         ***       |  |***        |  | |  |                               ***                       *** *** || ||    ***         ***            ||  |      ***    |   |              ***|                   |  |            | ||  |     |  |  |  |                                ..nest..   |  |                                               
search RasMol script viewer Motif-ligand binding stats  niche ..      ****  ****     ..                   ****           **** ****                                                               | |****                               |****             |   |              ****                   ****            *******     ****  ****                                ..niche..   ****                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     ..                                                                                                          | |  |                                |                 *****                                                                                                           ..ststaple..                                                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                     ..                                                                                                          * *  *                                *                                                                                                                                 ..REP00000..                                                      

chain D : SERINE/THREONINE-PROTEIN KINASE 3
member of: GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24361/searchPTHR24361_SF247PFAM:searchPF00069PROSITE PATTERNS:searchPS00107, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ13188
JMol viewer RasMol script viewer  NA 506D  ..                                                                                                              *                                                                                                                                                                                                ..NA ..                                   
JMol viewer RasMol script viewer  SO4 505D  ..        **                                                                     *                              |                                                                                                                                                                                                ..SO4 ..                                   
JMol viewer RasMol script viewer  SO4 504D  ..   **  *||                         *                                           |                              |                                                                                                                                                                                                ..SO4 ..                                   
JMol viewer RasMol script viewer  SO4 503D  ..   ||  |||                         |                                           |                              |                       *                      **                            *                                                                                                                   ..SO4 ..                                   
JMol viewer RasMol script viewer  MG 502D  ..   ||  |||                         |                                           |                              |                       |                  *   ||                            |                                                                                                                   ..MG ..                                   
JMol viewer RasMol script viewer  ANP 501D  ..   ||  |||              ***   *    |       * *                                 |         * *      *           |                       |       *          *   ||                            |                                                                                                                   ..ANP ..                                   
sec str:  ......hhhhhhhhhhhheeeeeeeee....eeeeeee.....eeeeeeee...hhhhhhhhhhhhhh........eeeeeee..eeeeeee....eehhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee............hhhhhhh.......hhhhhhh.....hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh......hhhhhhhhhhhhhhhhh........hhhhhh.hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..... ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..LKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRNIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEE... ..LDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQ
seq num:  ..11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301          ... ..455       465       475       485  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | ||  || | || ||    ||  | |  |    || |||   ||   | || |  |  || |  | |  |                   |  ||| ||||||^*** ||  || || |||       | | | | || ||  | |||       | |||     | ||  |||  |      | | |  | | ||| ||||||| |  | || || ||||       | | |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00001.. |  ||      |   | |   | || || |||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. **^*  || | || ||    ||  | |  |    || |||   ||   | || |  |  || |  | |  |                   |  ||| |||||| ||  ||  || || |||       | | | | || ||  | |||       | |||     **^*  |||  |      | | |  | | ||| ||||||| |  | || || ||||       | | |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00004.. |  ||      |   | |   | || || |||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  || | || ||    ||  | |  |    || |||   ||   | || |  |  || |  | |  |                   |  ||| |||||| ||  ||  || || ^**       | | | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ||||||| |  | || || ||||       ^** |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00005.. |  ||      |   ^**   | || || |||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |  || | || ||    ||  | |  |    || |||   ||   | || |  |  || |  | |  |                   |  |^***||||| |^***|  || ||  ||       | | | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ^***||| |  | || || ||||           |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00006.. |  ||      |   |     | || || |||  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    |  || | || ||    ******^  |    || |||   ||   | || |  |  || |  | |  |                   |  | | |||||| |    |  || ||  ||       | | | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ||| ||| |  | || || ||||           |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00007.. |  ||      |   |     | || || |||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    |  || | || ||     |  ^*****    || |^*****|   | || |  |  || |  | |  |                   |  | | |||||| |    |  || ||  ||       | | | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ||| ||| |  | || || ||||           |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00008.. |  ||      |   |     | || || |||  
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..    |  || | || ||     ************************   | || |  |  || |  | |  |                   |  | | |||||| |    |  || ||  ||       | | | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ||| ||| |  | || || ||||           |  |      |  || | ||  |   | || |  |  |  |  | |  |||| ||  ||| |||   | |..PS00107.. |  ||      |   |     | || || |||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    |  || | *****                  || |||        | || |  ***** |  | |  |                   |  | *******| |    |  || |*****       | | | | || ||  | |||       | |||        |  |||  |      | | |  | ************| |  | || ******|           |  |      ***** | ||  |   | || |  |  |  |  | *******************   | |..alphabetamotif.. *****      |   |     | || ******  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    |  || | || ||                  ******        | || |  |  |  |  | |  |                   |  | | || ||| |    |  || ||  |        | | | | || ||  | |||       | |||        |  |||  |      | | |  | | ||| ||  | | |  | || || || |           |  |      |  |  | ||  |   | || |  |  |  |  | |  | || ||  ||| ||    | |..betabulgeloop.. |  |       |   |     | || || ||   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |  || | ****|                   ****|        | || |  ****  |  | |  |                   **** *******| |    ***********        | | | | || ||  ****|       ****|        ****||  |      | | **** *********** | |  **** *******           |  |      ****  | |****   **** |  |  |  **** **** *************    | |..betaturn.. ****       |   |     **********   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    |  || |  |  |                     | |        | || |        |  | |  |                               | |                       | | | | || ||    | |         | |            ||  |      | |    |   |         | |  | ||                   |  |            | ||  |     |  |  |  |                             ***..gammaturn..            |   |                  
search RasMol script viewer Motif-ligand binding stats  nest ..    |  || |  |  |                     ***        | |***        |  | |  |                               ***                       *** *** || ||    ***         ***            ||  |      ***    |   |         ***  ***|                   |  |            | ||  |     |  |  |  |                                ..nest..            |   |                  
search RasMol script viewer Motif-ligand binding stats  niche ..    |  ****  ****                                ***           **** ****                                                               | |****                               |****             |   |              ****                   ****            *******     ****  ****                                ..niche..            |   |                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..    *****                                                                                                                              | |  |                                |                 |   |                                                                                                           ..stmotif..            |   |                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                       | |  |                                |                 *****                                                                                                           ..ststaple..            *****                  
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                       * *  *                                *                                                                                                                                 ..REP00000..                                   

chain G : RAS ASSOCIATION DOMAIN FAMILY MEMBER 5, RASSF5
member of: PANTHER:searchPTHR22738/searchPTHR22738_SF9PROSITE PROFILES:searchPS50951, UniProt:searchQ8WWW0
JMol viewer RasMol script viewer  SO4 505D  ..             *                                  
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..EVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
seq num:  ..366       376       386       396       406     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |^*** ||  ^*** ||||||  || ||   |  || |||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |  *****  | ********|  || ||   *********  
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |  ******** *********  *****   ********   
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                                         

chain H : RAS ASSOCIATION DOMAIN FAMILY MEMBER 5, RASSF5
member of: PANTHER:searchPTHR22738/searchPTHR22738_SF9PROSITE PROFILES:searchPS50951, UniProt:searchQ8WWW0
JMol viewer RasMol script viewer  NA 505C  ..             *                          
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.
sequence :  ..EVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQK
seq num:  ..366       376       386       396       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |^***|  ||^*** |||  |             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |    *****| *****|  |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |    **** ****** ****             
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                                 

   New search    4lgd:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors