triangle PDBeMotif: 4lg8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification dna binding protein    | release date: Thu, Jun 27, 2013
Title crystal structure of prpf19 wd40 repeats
Authors A.M.EDWARDS, C.BOUNTRA, C.H.ARROWSMITH, C.XU, E.DOBROVETSKY, H.HE, J.MIN, STRUCTURAL GENOMICS CONSORTIUM (SGC), W.TEMPEL
Method X-RAY DIFFRACTION (resolution: 1.89Å)
PDBe Citation   
Small molecules:    search UNX UNX binding statistics UNX   search NA NA binding statistics NA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MHHHHHHSSGRENLYFQGTPEIIQKLQDKATVLTTERKERGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLC
PSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVT
GLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPG
HSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILH
FTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PRE-MRNA-PROCESSING FACTOR 19
member of: GENE3D:searchG3DSA_2.130.10.10PANTHER:searchPTHR13889PFAM:searchPF00400PRINTS:searchGPROTEINBRPTPROSITE PATTERNS:searchPS00678, PROSITE PROFILES:searchPS50082/searchPS50231/searchPS50294, SMART:searchSM00320SUPERFAMILY:searchSSF50978UniProt:searchQ9UMS4
JMol viewer RasMol script viewer  UNX 616A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 615A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 614A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 613A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 612A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 611A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 610A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 609A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 608A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 607A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 606A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 605A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 604A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  UNX 603A  ..                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  NA 602A  ..                                                                                                                                                                                                                                                                                     *                                
JMol viewer RasMol script viewer  NA 601A  ..                                                                                                                                                                                                                         * *                   *                                     |                                
sec str:  .......hhhhhh..eeeeee..........eeeeeee..eeeeeeeee....eeeee....eeeeee........eeee.....eeeee.....eeeee....eeeeee......eeeeee.....eeeeee...eeeeee.....eeeeee.......eeeeee.....eeeeee....eeeee....eeeeee......eeeeee.....eeeeee...eeeeee....eeeeeee......eeeeee.....eeeeee..eeeee....eeeeee......eeeeee.hhhh.eeeee....eeeee.
sequence :  ..PEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL
seq num:  ..195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| | |   |  |  ||  || |  |            ||||    | | ||   | || | ||| |  |||||      ||||    | | | |  || ^***||              | ||||  | ||| |       | | ||      |||   |     ||||  ||  | |       | |    |  |         | ||||| |  || | |  |||| |       | ||| ||     ||||  |           | | ||  | | |    |  |  | |   || | |||    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|| | |   |  |  ||  || |  |            ||||    | | ||   | || | ||| |  |**^*      ||||    | | | |  || ||| ||              | ||||  | ||| |       | | ||      |||   |     ||||  ||  | |       | |    |  |         | ||||| |  || | |  |||| |       | ||| ||     ||||  |           | | ||  | | |    |  |  | |   || | |||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| | |   |  |  ||  || |  |            |^**    | | ||   | || | ||^**  ^**        ||||    | | ^**  || ||| ||              | ||||  | ||| |       ^** ||      |||   |     ||||  ||  | |       | |    |  |         | ||||| |  || ^**  |||| |       | ||| ||     ||||  |           | | ||  | | |    |  |  | |   || | ^**    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..** | |   |  |  ||  || |  |            | ||    | | ||   | || | ||                ||||    | | |    || ||| ||              | ||||  ^***| |       | | ||      |||   |     ||||  ||  | |       | |    |  |         | ||||| ^***| |    |||| |       | ||| ||     ||||  |           | | ||  | | |    |  |  | |   ^*** ||     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|  | *******^  ||  || |  |            | ||    | | ||   | || | ||                ||||    | | |    || ||| ||              | ||||    | | |       | | ||      |||   |     ||||  ||  | |       | |    |  |         | |||||     | |    |||| |       | ||| ||     ||||  |           | | ||  | | |    |  |  | |    | | ||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |     |  |  ||  |^*****            | ||    ^*****   | || | ||                ||||    | | |    || ||| ||              | ||||    | | |       | | ||      |^*****     |^*****^*****       | |    |  |         | |||||     | |    |||| |       | ||| ||     |^*****           | | ||  | | ^*****  |  | |    ^*****     
search RasMol script viewer Motif-ligand binding stats  WD_REPEATS_1 ..|  |     |  |  ||  |  |               | ||      | |    | || | ||                ||||    | | |    || ||| ||              | ||||    | | |       | | ||      | |         ||||      | |       | |    |  |         | ||||***************|| |       | ||| ||     ||||              | | ||  | |         |  | |      | |      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|  |     |  |  ||  |  |               | ||      | |    | || | ||                ||||    | | |    || ||| ||              | ||||    | | |       | | ||      | |         ||||      | |       | |    |  |         | ||||      | |    | || |       ***** ||     ||||              | | ||  | |         |  | |      | |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |     |  |  ||  |  |               ***|      ***    ***| | ||                ||||    | ***    || ||| ||              | ||||    | ***       | | ||      | |         ||||      | |       | |    |  |         | ***|      ***    ***| |       ***|  ||     ||||              | | ||  | |         |  | |      ***      
search RasMol script viewer Motif-ligand binding stats  betabulge ..|  |     |  |  **  |  |               |  |      | |    |  | | **                ||||    | | |    || ||| **              | ||||    | | |       | | **      | |         ||||      | |       | |    |  |         | ||||      | |    |  | |       |  |  **     ||||              | | **  | |         |  | |      | |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..|  |     |  |      |  |               |  |      | |    ******                   ||||    | | |    || |||                 | ||||    | | |       | |         | |         ||||      | |       | |    |  |         | ||||      | |    ******       |  |         ||||              | |     | |         |  | |      | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |     |  |      |  |               |  |      | |       | |                   ||||    | | |    |****|                 ****||    | | |       | |         | |         ||||      | |       | |    |  |         | ||||      | |       | |       ****         ||||              | |     | |         **** |      | |      
search RasMol script viewer Motif-ligand binding stats  nest ..|  |     |  |      |  |               |  |      ***       ***                   ****    | ***    |  ***                   ****    | ***       ***         ***         ****      ***       ***    |  |         | ****      ***       ***       |  |         ****              ***     | |            ***      ***      
search RasMol script viewer Motif-ligand binding stats  niche ..****     ****      ****               ****                | |                    ***    | |      |    |                   | |     | |         | |                                                ****         | |***                          ****         | |                       ***                              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                          | |                           | |      ******                   | |     | |         | |                                                             | |                                          | |                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                          ***                           ***                               ***     ***         ***                                                             ***                                          ***                                                        

   New search    4lg8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors