triangle PDBeMotif: 4l2a  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.15.1.1
Classification oxidoreductase    | release date: Tue, Jun 4, 2013
Title x-ray structure of the c57r mutant of the iron superoxide di from pseudoalteromonas haloplanktis (crystal form ii)
Authors A.MERLINO, F.SICA, I.RUSSO KRAUSS
Method X-RAY DIFFRACTION (resolution: 2.06Å)
PDBe Citation   
Small molecules:    search FE FE binding statistics FE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
AFELPSLPYAIDALEPHISKETLEFHHGKHHNTYVVKLNGLIPGTKFENKSLEEIVRSSDGGVFNNAAQIWNHTFYWNSL
SPNGGGAPTGAVADAINAKWGSFDAFKEALNDKAVNNFGSSWTWLVKLADGSLDIVNTSNAATPLTDDGVTPILTVDLWE
HAYYIDYRNVRPDYLKGFWSLVNWEFANANFA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SUPEROXIDE DISMUTASE [FE]
member of: GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchP84612
JMol viewer RasMol script viewer  FE 5000A  ..                         *                                              *                                                                                   *   *                               
sec str:  ....................hhhhhhhhh.hhhhhhhhhhhhhh........hhhhhhh..hhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee.....eeeeeee...hhhhh...eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..AFELPSLPYAIDALEPHISKETLEFHHGKHHNTYVVKLNGLIPGTKFENKSLEEIVRSSDGGVFNNAAQIWNHTFYWNSLSPNGGGAPTGAVADAINAKWGSFDAFKEALNDKAVNNFGSSWTWLVKLADGSLDIVNTSNAATPLTDDGVTPILTVDLWEHAYYIDYRNVRPDYLKGFWSLVNWEFANANFA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | || |  ||   |              | |||| | ||^*** ||| || |    |     ^***|| ||| |||    |         |||   |       |  | |    |   | |||    ^*** |||| |  |      | | |  |  |  |       || |||   |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         | || |  ||   |              | |||| ^*** |^***|| || |    |        ||| ||| |||    |         |||   |       |  | |    |   | |||      || |||| |  |      | | |  |  |  |       || |||   |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | || |  ||   |              | ^***** |  ||   || || ^*****        ||| ||| ||^*****         |^*****       |  | ^*****   | |||      || |||| |  |      | | |  |  |  |       || |||   |     
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..         | || |  ||   |              | |||| | |  ||   || ||               ||| ||| |||              | |           |  |          | |||      || |||| |  |      ^***^***  |  |       || |||   |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | || |  ||   |              *****| | |  ||   || ||               ||| ||| |||              | |           |  |          | |||      || |||| |  |      | |       |  |       *****|   |     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         | || |  ||   |              | |||| | |  ||   || ||               ||| ||| |||              | |           |  |          | |||      || |||| |  |      | |       |  |       || ||*****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..         **** |  ||   |              ****|| | |  ||   ****|               |****|****|              | |           |  |          ****|      ****|*******      | |       ****       ****|          
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |  ||   |                | || | |  ||   ||  |               | | ||| | |              ***           |  |            ***       | |||| |  |      | |                   |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..           *******|   |                ****** ****|   |****               | ****| | |                            ****                      ***|*******      ***                   ****          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                  *****                     | |   *****   |               |   | *****                                                         | |                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            | |       *****               ***** | |                                                           | |                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                            ***                                 ***                                                           ***                                               

chain B : SUPEROXIDE DISMUTASE [FE]
member of: GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchP84612
JMol viewer RasMol script viewer  FE 5001B  ..                         *                                              *                                                                                   *   *                               
sec str:  ....................hhhhhhhhh.hhhhhhhhhhhhhh........hhhhhhh..hhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee.....eeeeeee...hhhhh...eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..AFELPSLPYAIDALEPHISKETLEFHHGKHHNTYVVKLNGLIPGTKFENKSLEEIVRSSDGGVFNNAAQIWNHTFYWNSLSPNGGGAPTGAVADAINAKWGSFDAFKEALNDKAVNNFGSSWTWLVKLADGSLDIVNTSNAATPLTDDGVTPILTVDLWEHAYYIDYRNVRPDYLKGFWSLVNWEFANANFA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | || |  ||   |              | |||| | ||^*** ||| || |    |     ^***|| ||| |||    |         |||   |       |  | |    |   | |||    ^*** |||| |  |      | | |  |  |  |      ||||||| |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         | || |  ||   |              | |||| ^*** |^***|| || |    |        ||| ||| |||    |         |||   |       |  | |    |   | |||      || |||| |  |      | | |  |  |  |      ||||||| |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | || |  ||   |              | ^***** |  |   ||| || ^*****        ||| ||| ||^*****         |^*****       |  | ^*****   | |||      || |||| |  |      | | |  |  |  |      ||||||| |       
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..         | || |  ||   |              | |||| | |  |   ||| ||               ||| ||| |||              | |           |  |          | |||      || |||| |  |      ^***^***  |  |      ||||||| |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | || |  ||   |              *****| | |  |   ||| ||               ||| ||| |||              | |           |  |          | |||      || |||| |  |      | |       |  |      ******| |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | || |  ||   |              | |||| | |  |   ||| ||               ||| ||| |||              | |           |  |          | ***      || |||| |  |      | |       |  |      ||||||***       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         | || |  ||   |              | |||| | |  |   ||| ||               ||| ||| |||              | |           |  |          *****      || |||| |  |      | |       |  |      ||||||          
search RasMol script viewer Motif-ligand binding stats  betaturn ..         **** |  ||   |              ******** |  |   |****|               |****|****|              | |           ****          ****|      ****|*******      | |       ****      *****|          
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |  ||   |                | || | |  |   ||| ||               | | ||| | |              ***           |  |            ***       | |||| |  |      | |                   |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..           *******|   |                ****** ****   ||****               | ****| | |                            ****                      ***|*******      ***                   ****          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                  *****                     | |      ||  ||               |   | *****                                                         | |                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            | |      ******               ***** | |                                                           | |                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                            ***                                 ***                                                           ***                                               

   New search    4l2a:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors