triangle PDBeMotif: 4kzi  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription    | release date: Thu, May 30, 2013
Title crystal structure of tr3 lbd in complex with dpdo
Authors A.LI, F.LI, H.CHEN, Q, Q.CAI, Q.ZHANG, W.WANG, X.TIAN, Y.WANG, Y.XING
Method X-RAY DIFFRACTION (resolution: 2.41Å)
PDBe Citation   
Small molecules:    search ZJ0 ZJ0 binding statistics ZJ0   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains B,A sequence:
MSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAE
LSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSAL
VLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIID
KIFMDTLPFLEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : NUCLEAR RECEPTOR SUBFAMILY 4 GROUP A MEMBER 1
member of: GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24085/searchPTHR24085_SF1PFAM:searchPF00104PRINTS:searchHMRNUCRECPTR/searchNUCLEARECPTR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP22736
JMol viewer RasMol script viewer  GOL 701B  ..           *  **                  ..                                                     *   *                                                                                            ..GOL ..                                                  
sec str:  ...hhhhhhhhhhhhhh.......................hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eee.....eeehhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh....... ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh..
sequence :  ..PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPH..KEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEP... ..ASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
seq num:  ..361       371       381       391 ..397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       ... ..549       559       569       579       589       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |   |     || || |^**|||| |       ..  | |         |  |      |  | ||| ||  || |   |         ||  | | |||  | |||  || |||                 | |||    |   | |  |^**  |                            ..PS00005..|   | |  |                    ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |   |     || || |||||||| |       ..  | |         |  |      |  | ||| |^***| |   |         ||  | | |||  | |||  || |||                 | |||    |   | |  |  |  |                            ..PS00006..|   | |  |                    ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER .. |   |     || || |||||||| |       ..  | |         |  |      |  | ||| **********************|  | | |||  | |||  || |||                 | |||    |   | |  |  |  |                            ..PS00029..|   | |  |                    ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |   |     || || |||||||| |       ..  | |         |  |      |  | ||| ||   | |   |          |  | | |||  | |||  ******                 | |||    |   | |  |  |  |                            ..alphabetamotif..|   | |  |                    ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  asxturn .. |   |     || || |||||*** |       ..  ***         |  |      |  | ||| ||   | |   |          |  | | |||  | |||  || ||                  | |||    |   | |  |  |  |                            ..asxturn..|   | |  |                    ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. |   |     || || ||||| |  |       ..              |  |      |  | ||| ||   | |   |          |  | | |||  *****  || ||                  | |||    |   | |  |  |  |                            ..betabulgeloop..|   | |  |                    ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  betaturn .. |   |     ****| ****| |  |       ..              ****      **** ||| ||   | |   |          |  | ****|  ****|  *****                  ****|    |   | |  |  |  |                            ..betaturn..|   | ****                    ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |   |      |  | ||| | |  |       ..                        |  | ||| ||   | |   |          |  |   | |    | |                           | |    |   | |  |  |  |                            ..gammaturn..|   |                         ||||        | | |***
search RasMol script viewer Motif-ligand binding stats  nest .. |   |      |  | ||| | |  |       ..                        |  | *** ||   | |   |          |  |   ***    ***                           ***    |   | |  |  |  |                            ..nest..|   |                         ****        | | ||  
search RasMol script viewer Motif-ligand binding stats  niche .. |   |      **** |**** ****       ..                        ****  ****|   | |   |          ****          | |                                  |   | ****  ****                            ..niche..|   |                                     | ****  
search RasMol script viewer Motif-ligand binding stats  stmotif .. |   |           *****            ..                                  ***** |   |                        | |                                  |   |                                       ..stmotif..|   |                                     |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple .. *****           | |              ..                                        *****                        | |                                  *****                                       ..ststaple..*****                                     *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                 ***              ..                                                                     ***                                                                              ..stturn..                                                  

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NUCLEAR RECEPTOR SUBFAMILY 4 GROUP A MEMBER 1
member of: GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24085/searchPTHR24085_SF1PFAM:searchPF00104PRINTS:searchHMRNUCRECPTR/searchNUCLEARECPTR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP22736
JMol viewer RasMol script viewer  ZJ0 703A  ..                                                                               ** **                                                                *  ***                             ..ZJ0 ..             *  *                                
JMol viewer RasMol script viewer  GOL 702A  ..          *  ***                                                               || ||    *   *                                                       |  |||                             ..GOL ..             |  |                                
JMol viewer RasMol script viewer  GOL 701A  ..          |  |||                                                               || ||    |   |                                                      **  |||                             ..GOL ..             |  |                                
sec str:  ...hhhhhhhhhhhhh.......................hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eee.....eeehhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh... ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh..
sequence :  ..ANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAG... ..SCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
seq num:  ..362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532          ... ..550       560       570       580       590      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   |     || ||  ^**| |  |      |  |                      || || ||| ||  || |   |         ||  |   | |    | |   |  ||                 | ||||   |   |     ^**  |                          ..PS00005..     || |||   |              ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   |     || ||  |  | |  |      |  |                      || || ||| |^***| |   |         ||  |   | |    | |   |  ||                 | ||||   |   |       |  |                          ..PS00006..     || |||   |              ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..|   |     || ||  |  | |  |      |  |                      || || ||| **********************|  |   | |    | |   |  ||                 | ||||   |   |       |  |                          ..PS00029..     || |||   |              ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|   |     || ||  |  | |  |      |  |                      || || ||| ||   | |   |          |  |   | |    | |   *****                 | ||||   |   |       |  |                          ..alphabetamotif..     || |||   |              ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|   |     || ||  |  | |  |      |  |                      || || ||| ||   | |   |          |  |   | |    | |   |  |                  | |||*****   |       |  |                          ..asxmotif..     || |||   |              ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..|   |     ****|  |  | |  |      |  |                      ********| ||   | |   |          |  |   | |    | |   ****                  ****|    |   |       |  |                          ..betaturn..     *****|   |              ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  nest ..|   |      |  |  |  | |  |      |  |                       |  | *** ||   | |   |          |  |   ***    ***                           ***    |   |       |  |                          ..nest..          |   |              ****        | | ||  
search RasMol script viewer Motif-ligand binding stats  niche ..|   |      ****  **** ****      ****                       ****  ****|   | |   |          ****                                               |   |       ****                          ..niche..          |   |                          | ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..|   |                                                                ***** |   |                                                             |   |                                     ..stmotif..          |   |                          |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..*****                                                                      *****                                                             *****                                     ..ststaple..          *****                          *****   

   New search    4kzi:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors