triangle PDBeMotif: 4kyi  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding/transport protein    | release date: Wed, May 29, 2013
Title legionella pneumophila effector
Authors A.H.GASPAR, A.HIERRO, A.L.ROJAS, C.PALLARA, J.FERNANDEZ-RECIO, M.LUCAS, M.P
Method X-RAY DIFFRACTION (resolution: 3.08Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search GNP GNP binding statistics GNP   search GOL GOL binding statistics GOL   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,C,E,G sequence:
GAMGSEISKTEAGQYSVSAPEHKGLVLSGGGAKGISYLGMIQALQERGKIKNLTHVSGASAGAMTASILAVGMDIKDIKK
LIEGLDITKLLDNSGVGFRARGDRFRNILDVIYMMQMKKHLESVQQPIPPEQQMNYGILKQKIALYEDKLSRAGIVINNV
DDIINLTKSVKDLEKLDKALNSIPTELKGAKGEQLENPRLTLGDLGRLRELLPEENKHLIKNLSVVVTNQTKHELERYSE
DTTPQQSIAQVVQWSGAHPVLFVPGRNAKGEYIADGGILDNMPEIEGLDREEVLCVKAEAGTAFEDRVNKAKQSAMEAIS
WFKARMDSLVEATIGGKWLHATSSVLNREKVYYNIDNMIYINTGEVTTTNTSPTPEQRARAVKNGYDQTMQLLDSHKQTF
DHPLMAILYIGHDKLKDALIDEKSEKEIFEASAHAQAILHLQEQIVKEMNDGDYSSVQNYLDQIEDILTVDAKMDDIQKE
KAFALCIKQVNFLSEGKLETYLNKVEAEAKAAAEPSWATKILNLLWAPIEWVVSLFKGPAQDFKVEVQPEP
Chains B,D,F,H sequence:
GAMGSKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYR
GAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVN
EIFMAIAKKL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VIPD
member of: GENE3D:searchG3DSA_3.40.1090.10PANTHER:searchPTHR14226PFAM:searchPF01734SUPERFAMILY:searchSSF52151UniProt:searchQ5ZRP9
JMol viewer RasMol script viewer  EDO 303B  ..                                                                                                                                                                                                                                                                                                                                       ..EDO ..                                                                                                                         *   *                                                                             
JMol viewer RasMol script viewer  GOL 604A  ..                                                                                                                                                                                                                                                                                                                       *  *            ..GOL ..      *                                                                                                                  |   |                                                             *               
JMol viewer RasMol script viewer  GOL 603A  ..                                                                                                                                                                                                                                                                                                                       |  |            ..GOL ..  *   |*                                                                                                                 |   |                                                             |               
JMol viewer RasMol script viewer  EDO 602A  ..                                                                                                                                                                                                                                    *   *                              * * *                                           |  |            ..EDO ..  |   ||                                                                                                                 |   |                                                             |               
JMol viewer RasMol script viewer  EDO 601A  ..                                                                                                                                                                                                                                    |   |                              | | |                                           |  |      *     ..EDO ..* |   ||                                                                                                                 |   |                                                             |               
sec str:  .....eee.....eee......eeee.....hhhhhhhhhhhhhhh.......eeee.hhhhhhhhhhhh..hhhhhhhhhhh.hhhhhh..........hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh...................hhhhhhhhhhhh...hhhhh.eeeeeeee....eeeeee.......hhhhhhhhhh........ee.....eee..............hhh.eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhh...... ..................eeeee...........hhhhhhhhhhhhhhhhhhhhh....ee.hhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhh...........
sequence :  ..GSEISKTEAGQYSVSAPEHKGLVLSGGGAKGISYLGMIQALQERGKIKNLTHVSGASAGAMTASILAVGMDIKDIKKLIEGLDITKLLDNSGVGFRARGDRFRNILDVIYMMQMKKHLESVQQPIPPEQQMNYGILKQKIALYEDKLSRAGIVINNVDDIINLTKSVKDLEKLDKALNSIPTELKGAKGEQLENPRLTLGDLGRLRELLPEENKHLIKNLSVVVTNQTKHELERYSEDTTPQQSIAQVVQWSGAHPVLFVPGRNAKGEYIADGGILDNMPEIEGLDREEVLCVKAEAGTAFEDRVNKAKQSAMEAISWFKARMDSLV... ..TSSVLNREKVYYNIDNMIYINTGEVTTTNTSPTPEQRARAVKNGYDQTMQLLDSHKQTFDHPLMAILYIGHDKLKDALIDEKSEKEIFEASAHAQAILHLQEQIVKEMNDGDYSSVQNYLDQIEDILTVDAKMDDIQKEKAFALCIKQVNFLSEGKLETYLNKVEAEAKAAAEPSWATKILNLLWAPIEWVVSLFKGPAQDFK
seq num:  ..17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337    ... ..355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |  || |   |  |  |    || |  |   |    || |||| ^***  ||  |||  |   | || |       |  |||||   |  |  |||| |      |       |  |     |  ||  ||        |   | |||   |     ^***| ||       |  |   |         | | |  |    |  ||  ||  | ^***   ^***||        |  |       |  | |  |    | |||   | | |  |  |  | |  |        |  |        |  |    |  || || ..PS00001.. | |          | |   | |  |  |   | |        |   |  | || |         |  ||| ||  |  | || |||   |              |   | ||                 | |               |   | | |                 | |     |  ||  || | |  | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |  || |   |  |  |    || |  |   |    || ||||  |    ||  |||  |   | || |       |  |||||   |  |  |||| |      |       |  |     |  ||  ||        |   | |||   |      |  ^**|       |  |   |         | | |  |    |  ||  ||  |        | ||||        |  |       |  | |  |    | |||   | | |  |  |  | |  |        |  |        |  |    |  || || ..PS00005.. | |          | |   | |  |  |   | |        |   |  | |^**         |  ||| ||  |  | |^**||   |              |   | ||                 | |               |   | | |                 | |     |  ||  || | |  | |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | ^***| |   ^***  |    || |  |   |    || ||||  |    ||  |||  |   | || |       |  |||||   |  |  |||| |      |       |  |     |  ||  ||        |   | |||   |      |  ^***       |  |   |         | | ^***    |  ||  ||  |        | ^***        |  |       |  | |  |    | |||   | | |  |  |  | |  |        ^***        ^***    |  || ^**..PS00006.. | |          | |   | |  |  |   | |        |   |  | || |         |  ||| ||  |  | |^***|   |              |   | ||                 | |               |   | | |                 | |     |  ||  || | |  | |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |     | |         |    || |  |   |    || ||||  |    ||  |||  |   | || |       |  |||||   |  |  |||| *******^       |  |     |  ||  ||        |   | |||   |      |  |          |  |   |         | |         |  ||  ||  |        |  |||        |  |       |  | |  |    | |||   | | |  |  |  | |  |                            |  ||  | ..PS00007.. | |          | |   | |  |  |   | |        |   |  | || |         |  ||| ||  |  | ||   |   |              *******^                 | |               |   | | |                 | |     |  ||  || | |  | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***     | |         ^*****^*****   ^*****| ||||  |    ^*****|  |   | || |       ^*****||   |  |  ||||                |  |     |  ||  ||        |   | |^*****      |  |          |  |   |         | |         |  ||  ||  |        |  |||        |  |       |  | |  |    | |||   | ^*****  |  | |  |                            |  ||  | ..PS00008.. | |          | |   | |  |  |   | |        |   |  | || |         |  ||| ||  |  | ||   |   |                  | |                  | |               |   | | |                 | |     |  ||  || | |  | |   
search RasMol script viewer Motif-ligand binding stats  RGD ..        | |               | |           || ||||  |     |  | |  |   | || |          || ||   |  |  ***|                |  |     |  ||  ||        |   | | |          |  |          |  |   |         | |         |  ||  ||  |        |  |||        |  |       |  | |  |    | |||   | | |     |  | |  |                            |  ||  | ..PS00016.. | |          | |   | |  |  |   | |        |   |  | || |         |  ||| ||  |  | ||   |   |                  | |                  | |               |   | | |                 | |     |  ||  || | |  | |   
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..        | |               | |           || ||||  |     |  | |  |   | || |          || ||   |  |  ||||                |  |     |  ||  ||        |   | | |          **********************         | |         |  ||  ||  |        |  |||        |  |       |  | |  |    | |||   | | |     |  | |  |                            |  ||  | ..PS00029.. | |          | |   | |  |  |   | |        |   |  | || |         |  ||| ||  |  | ||   |   |                  | |                  | |               |   | | |                 | |     |  ||  || | |  | |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |               | |           || ||||  |     |  | |  |   | || |          || ||   |  |  ||||                |  |     |  |*****        |   | | |          |  |          |  |             | |         |  |*****  |        |  |||        |  |       |  | |  |    | |||   | | |     |  | |  |                            *****  | ..alphabetamotif.. | |          | |   | |  |  |   | |        |   |  | || |         |  ||| ||  |  | ||   |   |                  | |                  | |               |   | | |                 | |     |  |***** | |  | |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        | |               | |           || ||||  |     |  | |  |   | || |          || ||   |  |  ||||                |  |     |  ||  |         |   | | |          |  |          |  |             | |         |  ||  ||  |        *****|        |  |       |  | |  |    | |||   | | |     |  | |  |                            |  ||  | ..asxmotif.. | |          | |   | |  |  |   | |        |   |  | || |         |  ||| ||  |  | ||   |   |                  | |                  | |               |   | | |                 | |     |  ||  |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |               | |           || ||||  |     |  | |  |   | |***          || ||   |  |  ||||                |  |     |  ||  |         |   | | |          |  |          |  |             | |         |  ||  ||  |        |  | |        |  |       |  | |  |    | |||   *** |     |  | |  |                            |  ||  | ..asxturn.. | |          | |   ***  |  |   | |        |   |  | || |         |  ||| ||  |  ***|   |   |                  | |                  | |               |   | | |                 | |     |  ||  |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        | |               | |           || ||||  |     |  | |  |   | |             || ||   |  |  ||||                |  |     |  ||  |         |   | | |          |  |          |  |             | |         |  ||  ||  |        ******        |  |       |  | |  |    *****     | |     |  | |  |                            |  ||  | ..betabulgeloop.. | |          | |        |  |   | |        |   |  | || |         |  ||| ||  |  |  |   |   |                  | |                  | |               |   | | |                 | |     |  ||  |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |               | |           |****|****     **** ****   | |             ****|   |  |  ||||                |  |     ********         |   | | |          |  |          |  |             | |         |  |****|  |           | |        |  |       **** |  |    ****|     | |     |  | |  |                            ****|  | ..betaturn.. | |          | |        |  |   | |        |   |  **** |         |  |****|  |  |  |   |   |                  | |                  | |               |   | | |                 | |     |  |****  | |  | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |               | |           |  ||||  |                 | |              |  |   |  |  ||||                |  |                      |   | | |          |  |          |  |             | |         |  |    |  |           | |        |  |            |  |      | |     | |     |  | |  |                                |  | ..gammaturn.. ***          | |        |  |   | |        |   |    |  |         |  | |  |  |  |  |   |   |                  | |                  | |               |   | | |                 | |     |  |   |  | |  ***   
search RasMol script viewer Motif-ligand binding stats  nest ..        ***               | |           |  ****  |                 ***              |  |   |  |  ****                |  |                      |   | ***          |  |          |  |             | |         |  |    |  |           ***        |  |            |  |      ***     | |     |  | |  |                                |  | ..nest..              | |        |  |   | |        |   |    |  |         |  | |  |  |  |  |   |   |                  ***                  ***               |   *****                 | |     |  |   |  | |        
search RasMol script viewer Motif-ligand binding stats  niche ..                          ***           |    |****                                  ****   ****                      ****                      |   |              ****          ****             ***         ****    ****                      ****            ****              ***     **** ****                                **** ..niche..              ***        ****   | |        |   |    ****         **** ****  *******   |   |                                                         |   |                     | |     ****   ******        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                        ******                                                                                                 |   |                                                                                                                                                                                   ..schellmannloop..                                | |        |   |                                      |   |                                                         |   |                     | |                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                               *****                                                                                                                                                                                   ..ststaple..                                | |        *****                                      *****                                                         *****                     | |                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                                                                                                       ..stturn..                                ***                                                                                                                                           ***                          

chain B : RAS-RELATED PROTEIN RAB-5C
member of: GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24073/searchPTHR24073_SF366PFAM:searchPF00071PRINTS:searchRASTRNSFRMNGPROSITE PROFILES:searchPS51419, SMART:searchSM00175SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00231UniProt:searchP51148
JMol viewer RasMol script viewer  MG 304B  ..                *                 *                                                                                                                                 
JMol viewer RasMol script viewer  EDO 303B  ..    *           |                 |                     *             **                                                                                            
JMol viewer RasMol script viewer  EDO 302B  ..    |           *  *              |     *               |*            ||                                                                                            
JMol viewer RasMol script viewer  GNP 301B  ..    |      ******* |       ***   **     |               ||  *         ||                                           ** **                         ***                
sec str:  ...eeeeeeee.....hhhhhhhhhh.............eeeeeeeeee..eeeeeeeeee..hhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhh..hhhhhhhhhhhh..eeee.......hhhhhhhhhhhhh
sequence :  ..ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
seq num:  ..19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |||||       | |                   |  |^**      | |      |  || ||   |   | || |   |  ||        |  |       | | |^** ||  ||   |  | |     ^**| || |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |||||       | |                   |  |         | |      |  || ||   |   | ^***   |  ||        |  |       | | |  | ||  ||   |  | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |||||       | |                   |  |         | |      |  || ^*****   | || |   |  ||        |  |       | | |  | ||  ||   |  | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..         ********       | |                   |  |         | |      |  ||  |       | || |   |  ||        |  |       | | |  | ||  ||   |  | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |||||       | |                   |  |         | |      *****  |       | || |   *****        |  |       | | |  | |*****   |  | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |||||       | |                   |  |         | |      |  ||  |       ******   |  |         |  |       | | |  | ||  |    |  | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            |||||       | |                   |  |         | |      |  ||  |       |  |     |  |         |  |       | | |  | ||  |    |  | |     ******| |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |||||       | |                   ****         | |      ****|  |       |  |     ****         |  |       | | |  | |****    **** |        | || |          
search RasMol script viewer Motif-ligand binding stats  nest ..            *****       ***                                | |          |  |       |  |                  |  |       *** |  | |           ***        ******          
search RasMol script viewer Motif-ligand binding stats  niche ..                                                           ***          ****       ****                  ****           ******                                      

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : VIPD
member of: GENE3D:searchG3DSA_3.40.1090.10PANTHER:searchPTHR14226PFAM:searchPF01734SUPERFAMILY:searchSSF52151UniProt:searchQ5ZRP9
sec str:  .....eee.hhh.eee......eeee.....hhhhhhhhhhhhhhh.......eeeee.hhhhhhhhhhh..hhhhhhhhhhhh..................hhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh.hhhhhhhhhhhhh....................hhhhhhhhhhh.........eeeeeeee....eeeeee.......hhhhhhhhhh........ee.....eee..............hhh.eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhh..... ................eeeee...........hhhhhhhhhhhhhhhhhhhhhhhh.ee.hhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh....hhhhhhhhhh.hhhhhh...........
sequence :  ..GSEISKTEAGQYSVSAPEHKGLVLSGGGAKGISYLGMIQALQERGKIKNLTHVSGASAGAMTASILAVGMDIKDIKKLIEGLDITKLLDNSGVGFRARGDRFRNILDVIYMMQMKKHLESVQQPIPPEQQMNYGILKQKIALYEDKLSRAGIVINNVDDIINLTKSVKDLEKLDKALNSIPTELKGAKGEQLENPRLTLGDLGRLRELLPEENKHLIKNLSVVVTNQTKHELERYSEDTTPQQSIAQVVQWSGAHPVLFVPGRNAKGEYIADGGILDNMPEIEGLDREEVLCVKAEAGTAFEDRVNKAKQSAMEAISWFKARMDSL... ..SVLNREKVYYNIDNMIYINTGEVTTTNTSPTPEQRARAVKNGYDQTMQLLDSHKQTFDHPLMAILYIGHDKLKDALIDEKSEKEIFEASAHAQAILHLQEQIVKEMNDGDYSSVQNYLDQIEDILTVDAKMDDIQKEKAFALCIKQVNFLSEGKLETYLNKVEAEAKAAAEPSWATKILNLLWAPIEWVVSLFKGPAQDFK
seq num:  ..17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337   ... ..357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |  |      |  |  |    || || ||  |    |  |||| ^***  ||  ||       | |          |   || |   |  |  |||| |      |       |  |    |  ||                   |||   |     ^***| ||       |  |   |   | |   | | |  |    |  ||  ||  | ^***   ^***||        |  |       |  | |  |      | |   | | |  |  |  | |  |        |  |        |  |          | ..PS00001..   | || |   | |   | |  || |   | |        |   |  |  | |             ||| |  |  |  | ||  |  ||            ||  ||||                 | |               |   | | |             | | | |     |  |   |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |  |      |  |  |    || || ||  |    |  ||||  |    ||  ||       | |          |   || |   |  |  |||| |      |       |  |    |  ||                   |||   |      |  ^**|       |  |   |   | |   | | |  |    |  ||  ||  |        | ||||        |  |       |  | |  |      | |   | | |  |  |  | |  |        |  |        |  |          | ..PS00005..   | || |   | |   | |  || |   | |        |   |  |  ^**             ||| |  |  |  ^**|  |  ||            ||  ||||                 | |               |   | | |             | | | |     |  |   |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | ^***      ^***  |    || || ||  |    |  ||||  |    ||  ||       | |          |   || |   |  |  |||| |      |       |  |    |  ||                   |||   |      |  ^***       |  |   |   | |   | | ^***    |  ||  ||  |        | ^***        |  |       |  | |  |      | |   | | |  |  |  | |  |        ^***        ^***          ^*..PS00006..   | || |   | |   | |  || |   | |        |   |  |  |               ||| |  |  |  ^***  |  ||            ||  ||||                 | |               |   | | |             | | | |     |  |   |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |                 |    || || ||  |    |  ||||  |    ||  ||       | |          |   || |   |  |  |||| *******^       |  |    |  ||                   |||   |      |  |          |  |   |   | |   | |         |  ||  ||  |        |  |||        |  |       |  | |  |      | |   | | |  |  |  | |  |                                    ..PS00007..   | || |   | |   | |  || |   | |        |   |  |  |               ||| |  |  |        |  ||            *******^                 | |               |   | | |             | | | |     |  |   |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***                 ^*****^*****|  ^*****  ||||  |    ^*****       | |          ^***** |   |  |  ||||                |  |    |  ||                   |^*****      |  |          |  |   |   | |   | |         |  ||  ||  |        |  |||        |  |       |  | |  |      | |   | ^*****  |  | |  |                                    ..PS00008..   | || |   | |   | |  || |   | |        |   |  |  |               ||| |  |  |        |  ||             |  |||                  | |               |   | | |             | | | |     |  |   |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  RGD ..                          | ||  |          ||||  |     |  |        | |              |  |   |  |  ***|                |  |    |  ||                   | |          |  |          |  |   |   | |   | |         |  ||  ||  |        |  |||        |  |       |  | |  |      | |   | | |     |  | |  |                                    ..PS00016..   | || |   | |   | |  || |   | |        |   |  |  |               ||| |  |  |        |  ||             |  |||                  | |               |   | | |             | | | |     |  |   |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..                          | ||  |          ||||  |     |  |        | |              |  |   |  |  ||||                |  |    |  ||                   | |          **********************   | |   | |         |  ||  ||  |        |  |||        |  |       |  | |  |      | |   | | |     |  | |  |                                    ..PS00029..   | || |   | |   | |  || |   | |        |   |  |  |               ||| |  |  |        |  ||             |  |||                  | |               |   | | |             | | | |     |  |   |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                          | ||  |          ||||  |     |  |        | |              |  |   |  |  ||||                |  |    *****                   | |          |  |          |  |       | |   | |         |  |*****  |        |  |||        |  |       |  | |  |      | |   | | |     |  | |  |                                    ..alphabetamotif..   | || |   | |   | |  || |   | |        |   |  |  |               ||| |  |  |        *****             *****|                  | |               |   | | |             | | | |     |  |   |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                          | ||  |          ||||  |     |  |        | |              |  |   |  |  ||||                |  |    |  |                    | |          |  |          |  |       | |   | |         |  ||  ||  |        *****|        |  |       |  | |  |      | |   | | |     |  | |  |                                    ..asxmotif..   | || |   | |   | |  || |   | |        |   |  |  |               ||| |  |  |        |  |              |  | |                  | |               |   | | |             | | | |     |  |   |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..                          | ||  |          ||||  |     |  |        | |              |  |   |  |  ||||                |  |    |  |                    | |          |  |          |  |       | |   | |         |  ||  ||  |           | |        |  |       |  | |  |      | |   *** |     |  | |  |                                    ..asxturn..   | || |   | |   ***  || |   | |        |   |  |  |               ||| |  |  |        |  |              |  | |                  | |               |   | | |             | | | |     |  |   |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                          | |****          ||||  |     ****        | |              |  |   |  |  ||||                |  |    ****                    | |          |  |          |  |       | |   | |         |  |****|  |           | |        |  |       **** |  |      | |     | |     **** |  |                                    ..betaturn..   | || |   | |     |  || |   | |        |   |  ****               ||| |  |  |        ****              **** |                  | |               |   | | |             | | | |     |  |   |  | |  | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                          | |              ||||  |                 | |              |  |   |  |  ||||                |  |                            | |          |  |          |  |       | |   | |         |  |    |  |           | |        |  |       |  | |  |      | |     | |     |  | |  |                                    ..gammaturn..   | || |   | |     |  |***   | |        |   |                     ||| |  |  |                             | |                  ***               |   | | |             | | | |     |  |   |  | |  ***   
search RasMol script viewer Motif-ligand binding stats  nest ..                          | |              ****  |                 ***              |  |   |  |  ****                |  |                            ***          |  |          |  |       ***   | |         |  |    |  |           ***        |  |       |  | |  |      ***     | |     |  | |  |                                    ..nest..   | || |   | |     |  |      | |        |   |                     ||| |  |  |                             ***                                    |   *****             *** | |     |  |   |  | |        
search RasMol script viewer Motif-ligand binding stats  niche ..                          ***                 ****                                  ****   ****                      ****                                         ****          ****             ***         ****    ****                      ****       **** ****              ***     **** ****                                    ..niche..   ******   ***     ****      | |        |   |                     *****  ****                                                                    |   |                     | |     ****   ******        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                                                                                                                                      ..ststaple..                              | |        *****                                                                                                    *****                     | |               | |        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                                                                                                      ..stturn..                              ***                                                                                                                                           ***               ***        

chain D : RAS-RELATED PROTEIN RAB-5C
member of: GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24073/searchPTHR24073_SF366PFAM:searchPF00071PRINTS:searchRASTRNSFRMNGPROSITE PROFILES:searchPS51419, SMART:searchSM00175SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00231UniProt:searchP51148
JMol viewer RasMol script viewer  MG 302D  ..                *                 *                                                                                                                                 
JMol viewer RasMol script viewer  GNP 301D  ..           ** ****         ***   **                         *                                                      ** **                         **                 
sec str:  ...eeeeeeeee....hhhhhhhhhh.............eee..eeeee..eeeeeeeeee..hhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhhhhhhhhh.....eeeeeee...hhhhh..hhhhhhhhhhhhh.eeee.......hhhhhhhhhhh..
sequence :  ..ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
seq num:  ..19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |||||       | | | |    | |            ^**               |  || |    |   | || |                           | | |^**             | |     ^**| || |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |||||       | | | |    | |                              |  || |    |   | ^***                           | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |||||       | | | |    | |                              |  || ^*****   |  |                             | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..         ********       | | | |    | |                              |  ||          |  |                             | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |||||       | | | |    | |                              *****          |  |                             | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            |||||       | | | |    | |                              |  |           |  |                             | | |  |             | |     ******| |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |||||       | | | |    | |                              ****           |  |                             | | |  |             | |        | || |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            |||||       | | | |    ***                                             |  |                             | | |  |             | |        | || |          
search RasMol script viewer Motif-ligand binding stats  nest ..            *****       *** | |                                                    |  |                             *** |  |             ***        ******          
search RasMol script viewer Motif-ligand binding stats  niche ..                            ***                                                    ****                                 ****                                        

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : VIPD
member of: GENE3D:searchG3DSA_3.40.1090.10PANTHER:searchPTHR14226PFAM:searchPF01734SUPERFAMILY:searchSSF52151UniProt:searchQ5ZRP9
JMol viewer RasMol script viewer  GOL 602E  ..                                                                                              ..                                                                                                                                                                                                                                         ..GOL ..  *  * *                                                                                                                                                                                                    
JMol viewer RasMol script viewer  EDO 601E  ..                                                                                              ..                                                                                                                                                                                                                             **          ..EDO ..  |  | |                                                                                                                                                                                                    
sec str:  .....eee.....eee......eeee.....hhhhhhhhhhhhhhhh......eeee..hhhhhhhhhhh..hhhhhhhhhhh.hhhhhh...........hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhh...hhhhhhhhhhhhh....................hhhhhhhhhhh.........eeeeeeee....eeeee........hhhhhhhhhh........ee.hhh.eee..............hhh.eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhh....... ...hhhhh..........eeeee...........hhhhhhhhhhhhhhhhhhhhhhhh.ee.hhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhh............
sequence :  ..GSEISKTEAGQYSVSAPEHKGLVLSGGGAKGISYLGMIQALQERGKIKNLTHVSGASAGAMTASILAVGMDIKDIKKLIEGLDITKLLDNSGVG..RARGDRFRNILDVIYMMQMKKHLESVQQPIPPEQQMNYGILKQKIALYEDKLSRAGIVINNVDDIINLTKSVKDLEKLDKALNSIPTELKGAKGEQLENPRLTLGDLGRLRELLPEENKHLIKNLSVVVTNQTKHELERYSEDTTPQQSIAQVVQWSGAHPVLFVPGRNAKGEYIADGGILDNMPEIEGLDREEVLCVKAEAGTAFEDRVNKAKQSAMEAISWFKARMDSLVE... ..TSSVLNREKVYYNIDNMIYINTGEVTTTNTSPTPEQRARAVKNGYDQTMQLLDSHKQTFDHPLMAILYIGHDKLKDALIDEKSEKEIFEASAHAQAILHLQEQIVKEMNDGDYSSVQNYLDQIEDILTVDAKMDDIQKEKAFALCIKQVNFLSEGKLETYLNKVEAEAKAAAEPSWATKILNLLWAPIEWVVSLFKGPAQDFKV
seq num:  ..17        27        37        47        57        67        77        87        97        107 ..112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332          ... ..355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |  |      |  |  |    || |  |   |    |  |||| ^***  || ||| |     | ||  ||     |  |||||      ..  |||| |      |       |  |    |  |                  | |||   ||  ||^***| ||       |  |   |         | | |  |    |  ||  ||  | ^***   ^***||    |   |  |       |  | |  |            | |    |  |  | |  |        |  |        |  |    |  || |  |..PS00001..        | |   | |   ||| ||  |              |   |  | || |              |  |  |  |  | ||                   ||| ||||                 | || |            ||| ||| |             | | | |     |  |   |  | | | | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |  |      |  |  |    || |  |   |    |  ||||  |    || ||| |     | ||  ||     |  |||||      ..  |||| |      |       |  |    |  |                  | |||   ||  || || ^**|       |  |   |         | | |  |    |  ||  ||  |        | ||||    |   |  |       |  | |  |            | |    |  |  | |  |        |  |        |  |    |  || |  |..PS00005..        | |   | |   ||| ||  |              |   |  | |^**              |  |  |  |  ^**|                   ||| ||||                 | || |            ||| ||| |             | | | |     |  |   |  | | | | |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | ^***      ^***  |    || |  |   |    |  ||||  |    || ||| |     | ||  ||     |  |||||      ..  |||| |      |       |  |    |  |                  | |||   ||  || || ^***       |  |   |         | | ^***    |  ||  ||  |        | ^***    |   |  |       |  | |  |            | |    |  |  | |  |        ^***        ^***    |  || ^***..PS00006..        | |   | |   ||| ||  |              |   |  | || |              |  |  |  |  ^***                   ||| ||||                 | || |            ||| ||| |             | | | |     |  |   |  | | | | |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |                 |    || |  |   |    |  ||||  |    || ||| |     | ||  ||     |  |||||      ..  |||| *******^       |  |    |  |                  | |||   ||  || || |          |  |   |         | |         |  ||  ||  |        |  |||    |   |  |       |  | |  |            | |    |  |  | |  |                            |  ||     ..PS00007..        | |   | |   ||| ||  |              |   |  | || |              |  |  |  |                         *******^                 | || |            ||| ||| |             | | | |     |  |   |  | | | | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***                 ^*****^*****   ^*****  ||||  |    ^***** |     | ||  ||     ^*****||      ..  ||||                |  |    |  |                  | |^*****|  || || |          |  |   |         | |         |  ||  ||  |        |  |||    |   |  |       |  | |  |            | ^*****  |  | |  |                            |  ||     ..PS00008..        | |   | |   ||| ||  |              |   |  | || |              |  |  |  |                          || |||                  | || |            ||| ||| |             | | | |     |  |   |  | | | | |   
search RasMol script viewer Motif-ligand binding stats  RGD ..                          | |              ||||  |     | ||  |     | ||  ||        || ||      ..  ***|                |  |    |  |                  | |||    |  || || |          |  |   |         | |         |  ||  ||  |        |  |||    |   |  |       |  | |  |            | |       |  | |  |                            |  ||     ..PS00016..        | |   | |   ||| ||  |              |   |  | || |              |  |  |  |                          || |||                  | || |            ||| ||| |             | | | |     |  |   |  | | | | |   
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..                          | |              ||||  |     | ||  |     | ||  ||        || ||      ..  ||||                |  |    |  |                  | |||    |  || **********************         | |         |  ||  ||  |        |  |||    |   |  |       |  | |  |            | |       |  | |  |                            |  ||     ..PS00029..        | |   | |   ||| ||  |              |   |  | || |              |  |  |  |                          || |||                  | || |            ||| ||| |             | | | |     |  |   |  | | | | |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                          | |              ||||  |     | ||  |     | |*****        || ||      ..  ||||                |  |    |  |                  | |||    ***** || |          |  |             | |         |  |*****  |        |  |||    |   |  |       |  | |  |            | |       |  | |  |                            *****     ..alphabetamotif..        | |   | |   ||| ||  |              |   |  | || |              |  |  |  |                          || |||                  | || |            ||| ||| |             | | | |     |  |   |  | | | | |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                          | |              ||||  |     | ||  |     | ||  |         || ||      ..  ||||                |  |    |  |                  | |||    |  || || |          |  |             | |         |  ||  ||  |        *****|    |   |  |       |  | |  |            | |       |  | |  |                            |  |      ..asxmotif..        | |   | |   ||| ||  |              |   |  | || |              |  |  |  |                          || |||                  | || |            ||| ||| |             | | | |     |  |   |  | | | | |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..                          | |              ||||  |     | ||  |     | ||  |         || ||      ..  ||||                |  |    |  |                  | |||    |  || || |          |  |             ***         |  ||  ||  |        |  | |    |   |  |       |  | |  |            ***       |  | |  |                            |  |      ..asxturn..        | |   | |   *** ||  |              |   |  | || |              |  |  |  |                          || |||                  | |***            ||| ||| |             | | | |     |  |   |  | | | | |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                          | |              ||||  |     | ||  |     | ||  |         || ||      ..  ||||                |  |    |  |                  | |||    |  || || |          |  |             | |         |  ||  ||  |        ******    |   |  |       |  | |  |                      |  | |  |                            |  |      ..betabulgeloop..        | |   | |    |  ||  |              |   |  | || |              |  |  |  |                          || |||                  | |               ||| ||| |             | | | |     |  |   |  | | | | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                          | |              |||****     ****  |     | |****         ****|      ..  ||||                |  |    ****                  ****|    ******** |          ****             | |         |  |****|  |           | |    |   |  |       **** |  |                      **** |  |                            ****      ..betaturn..        | |   | |    ****|  |              |   |  **** |              |  |  |  |                          |****|                  | |               ||****| |             | | | |     |  |   **** | | | |   
search RasMol script viewer Motif-ligand binding stats  nest ..                          | |              ****  |       |   |     ***              |  |      ..  ****                |  |                            ***          |  |          |  |             | |         |  |    |  |           ***    |   |  |       |  | |  |                      |  | |  |                                      ..nest..        | |   | |        |  |              |   |    |  |              |  |  |  |                          |  ***                  ***               ||  *****             *** | |     |  |   |  | | | ***   
search RasMol script viewer Motif-ligand binding stats  niche ..                          ***                 ****       |   |                      ****      ..                      ****                                         ****          ****             ***         ****    ****                  |   ****       **** ****                      **** ****                                      ..niche..        ***   ***        ****              |   |    ****              ****  ****                          |    |                                    ||  | |                   | |     ****   ******** ***   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                         |   |                                ..                                                                                                                                            |   |                                                                                        ..schellmannloop..                                           |   |                                                          ******                                    |******                   | |               | |         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                         *****                                ..                                                                                                                                            *****                                                                                        ..ststaple..                                           *****                                                                                                    *****                     | |               | |         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              ..                                                                                                                                                                                                                                         ..stturn..                                                                                                                                                                              ***               ***         

chain F : RAS-RELATED PROTEIN RAB-5C
member of: GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24073/searchPTHR24073_SF366PFAM:searchPF00071PRINTS:searchRASTRNSFRMNGPROSITE PROFILES:searchPS51419, SMART:searchSM00175SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00231UniProt:searchP51148
JMol viewer RasMol script viewer  MG 302F  ..                *                 *                                                                                                                                 
JMol viewer RasMol script viewer  GNP 301F  ..           ** ****         * *   **                                                                                ** *                          **                 
sec str:  ...eeeeeeeee.....hhhhhhhhhh............eeeeeeeee....eeeeeeeee...hhhhhhhhhhhh...eeeeeee..hhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhh..hhhhhhhhhhhh..eee........hhhhhhhhhhhh.
sequence :  ..ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
seq num:  ..19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |||||       | |                       ^**      | |      |  || ||   |   | || |            |  |           | | |^**             | |     ^**| || |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |||||       | |                                | |      |  || ||   |   | ^***            |  |           | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |||||       | |                                | |      |  || ^*****   |  | |            |  |           | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..         ********       | |                                | |      |  ||  |       |  | |            |  |           | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |||||       | |                                | |      *****  |       |  | |            |  |           | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |||||       | |                                | |      |  ||  |       |  ***            |  |           | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            |||||       | |                                | |      |  ||  |       |  |              |  |           | | |  |             | |     ******| |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |||||       | |                                | |      ****|  |       |  |              |  |           | | |  |             | |        | || |          
search RasMol script viewer Motif-ligand binding stats  nest ..            *****       ***                                | |          |  |       |  |              |  |           *** |  |             ***        ******          
search RasMol script viewer Motif-ligand binding stats  niche ..                                                           ***          ****       ****              ****               ****                        | |             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                    ***             

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain G : VIPD
member of: GENE3D:searchG3DSA_3.40.1090.10PANTHER:searchPTHR14226PFAM:searchPF01734SUPERFAMILY:searchSSF52151UniProt:searchQ5ZRP9
JMol viewer RasMol script viewer  EDO 601G  ..                                                                                              ..                                                                                                                             *            *                                              ***                                             ..EDO ..                                                                                                                                                                                                         
sec str:  .....eee.....eee......eeee.....hhhhhhhhhhhhhhh.......eeeee.hhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhh...hhhhhhhhhhhhh.....................hhhhhhhhhhhhhhh....eeeeeeee....eeeeee.......hhhhhhhhhh........ee.....eee..............hhh.eeeee..hhhhhhhhhhhhhhhhhhhhhhhhh.......... .................eee.............hhhhhhhhhhhhhhhhhhhhhhh..ee.hhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhh..........
sequence :  ..GSEISKTEAGQYSVSAPEHKGLVLSGGGAKGISYLGMIQALQERGKIKNLTHVSGASAGAMTASILAVGMDIKDIKKLIEGLDITKLLDNSGVG..RARGDRFRNILDVIYMMQMKKHLESVQQPIPPEQQMNYGILKQKIALYEDKLSRAGIVINNVDDIINLTKSVKDLEKLDKALNSIPTELKGAKGEQLENPRLTLGDLGRLRELLPEENKHLIKNLSVVVTNQTKHELERYSEDTTPQQSIAQVVQWSGAHPVLFVPGRNAKGEYIADGGILDNMPEIEGLDREEVLCVKAEAGTAFEDRVNKAKQSAMEAISWFKARMDSLVE... ..SSVLNREKVYYNIDNMIYINTGEVTTTNTSPTPEQRARAVKNGYDQTMQLLDSHKQTFDHPLMAILYIGHDKLKDALIDEKSEKEIFEASAHAQAILHLQEQIVKEMNDGDYSSVQNYLDQIEDILTVDAKMDDIQKEKAFALCIKQVNFLSEGKLETYLNKVEAEAKAAAEPSWATKILNLLWAPIEWVVSLFKGPAQDF
seq num:  ..17        27        37        47        57        67        77        87        97        107 ..112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332          ... ..356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |  || |   |  |  |    || |  |   |    || |||| ^***  ||  ||       | |        | ||  || || |   ..  |||| |      |       |  |                         || |||   |     ^***| |||      |  |   |   | |   | | | || |||| ||    |  | ^***   ^*** |        |  |           || ||      | |   | | | ||  |  | |  |        |  |        |  |    |  |  |  |..PS00001..       | |            | |      |  ||      |   |  | || |                   ||| |  | ||                   ||  |||||              | |    |  ||        |   | | |             | | | |     |  |   |  | |   | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |  || |   |  |  |    || |  |   |    || ||||  |    ||  ||       | |        | ||  || || |   ..  |||| |      |       |  |                         || |||   |      |  ^**||      |  |   |   | |   | | | || |||| ||    |  |          || |        |  |           || ||      | |   | | | ||  |  | |  |        |  |        |  |    |  |  |  |..PS00005..       | |            | |      |  ||      |   |  | |^**                   ||| |  ^**|                   ||  |||||              | |    |  ||        |   | | |             | | | |     |  |   |  | |   | | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | ^***| |   ^***  |    || |  |   |    || ||||  |    ||  ||       | |        | ||  || || |   ..  |||| |      |       |  |                         || |||   |      |  ^***|      |  |   |   | |   | | ^*** |||| ||    |  |          ^***        |  |           || ||      | |   | | | ||  |  | |  |        ^***        ^***    |  |  ^***..PS00006..       | |            | |      |  ||      |   |  | || |                   ||| |  ^***                   ||  |||||              | |    |  ||        |   | | |             | | | |     |  |   |  | |   | | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |     | |         |    || |  |   |    || ||||  |    ||  ||       | |        | ||  || || |   ..  |||| *******^       |  |                         || |||   |      |  |   |      |  |   |   | |   | |   |  |||| ||    |  |           | |        |  |           || ||      | |   | | | ||  |  | |  |                            |  |      ..PS00007..       | |            | |      |  ||      |   |  | || |                   ||| |  |                      *******^|              | |    |  ||        |   | | |             | | | |     |  |   |  | |   | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***     | |         ^*****^*****   ^*****| ||||  |    ^*****       | |        | ^***** || |   ..  ||||                |  |                         || |^*****      |  |   |      |  |   |   | |   | |   |  |||| ||    |  |           | |        |  |           || ||      | |   | ^*****  |  | |  |                            |  |      ..PS00008..       | |            | |      |  ||      |   |  | || |                   ||| |  |                       |  ||| |              | |    |  ||        |   | | |             | | | |     |  |   |  | |   | | 
search RasMol script viewer Motif-ligand binding stats  RGD ..        | |               | |            | ||||  |     |  |        | |        |  |  |  || |   ..  ***|                |  |                         || |||          |  |   |      |  |   |   | |   | |   |  |||| ||    |  |           | |        |  |           || ||      | |   | | | |   |  | |  |                            |  |      ..PS00016..       | |            | |      |  ||      |   |  | || |                   ||| |  |                       |  ||| |              | |    |  ||        |   | | |             | | | |     |  |   |  | |   | | 
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..        | |               | |            | ||||  |     |  |        | |        |  |  |  || |   ..  ||||                |  |                         || |||          **********************   | |   | |   |  |||| ||    |  |           | |        |  |           || ||      | |   | | | |   |  | |  |                            |  |      ..PS00029..       | |            | |      |  ||      |   |  | || |                   ||| |  |                       |  ||| |              | |    |  ||        |   | | |             | | | |     |  |   |  | |   | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |               | |            | ||||  |     |  |        | |        |  |  |  || |   ..  ||||                |  |                         || |||          |  |   |      |  |       | |   | |   **********    |  |           | |        |  |           *****      | |   | | | |   |  | |  |                            |  |      ..alphabetamotif..       | |            | |      *****      |   |  | || |                   ||| |  |                       *****| |              | |    *****        |   | | |             | | | |     |  |   |  | |   | | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |               | |            | ||||  |     |  |        | |        |  |  |  || |   ..  ||||                |  |                         || |||          |  |   |      |  |       | |   | |   |  | || ||    |  |           | |        |  |           || ||      | |   *** | |   |  | |  |                            |  |      ..asxturn..       | |            | |      |  ||      |   |  | || |                   *** |  |                       |  | ***              | |    |  |         |   | | |             | | | |     |  |   |  | |   | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |               | |            ****|****     ****        | |        |  |  |  || |   ..  ||||                |  |                         |****|          |  |   |      |  |       | |   | |   **** ****|    |  |           | |        |  |           ****|      | |     | | |   **** |  |                            ****      ..betaturn..       | |            | |      ****|      |   |  **** |                    |  |  |                       **** |                | |    ****         |   | | |             | | | |     |  |   **** |   | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |               | |              ||||  |                 | |        |  |  |  |***   ..  ||||                |  |                         |  | |          |  |   |      |  |       | |   | |         |  |    |  |           | |        |  |            |  |      | |     | ***   |  | |  |                                      ..gammaturn..       | |            ***      |   |      |   |    |  |                    |  |  |                          | |                | |                 |   | | |             | | | |     |  |   |  | |   | | 
search RasMol script viewer Motif-ligand binding stats  nest ..        ***               | |              ****  |                 ***        |  |  |  |      ..  ****                |  |                         |  ***          |  |   |      |  |       ***   | |         |  |    |  |           ***        |  |            |  |      ***     | |     |  | |  |                                      ..nest..       | |                     |   |      |   |    |  |                    |  |  |                          ***                | |                 |   *****             *** | |     |  |   |  | |   *** 
search RasMol script viewer Motif-ligand binding stats  niche ..                          ***                 ****                            ****  ****      ..                      ****                         |    |          ****   |      ****             ***         ****    ****                      ****            ****              ***     **** ****                                      ..niche..       ***                     |   |      |   |    ****                    *******                                             ***                 |   |                     | |     ****   ******       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                              ..                                                   ******             |   |                                                                                                                                                              ..schellmannloop..                               |   |      |   |                                                                                                    |   |                     | |               | |       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                              ..                                                                      *****                                                                                                                                                              ..stmotif..                               *****      |   |                                                                                                    |   |                     | |               | |       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                              ..                                                                                                                                                                                                                                         ..ststaple..                                          *****                                                                                                    *****                     | |               | |       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              ..                                                                                                                                                                                                                                         ..stturn..                                                                                                                                                                             ***               ***       

chain H : RAS-RELATED PROTEIN RAB-5C
member of: GENE3D:searchG3DSA_3.40.50.300PANTHER:searchPTHR24073/searchPTHR24073_SF366PFAM:searchPF00071PRINTS:searchRASTRNSFRMNGPROSITE PROFILES:searchPS51419, SMART:searchSM00175SUPERFAMILY:searchSSF52540TIGRFAMS:searchTIGR00231UniProt:searchP51148
JMol viewer RasMol script viewer  MG 302H  ..                *                 *                                                                                                                                 
JMol viewer RasMol script viewer  GNP 301H  ..           *******         ***   **                         *                                                      ** *                          ***                
sec str:  ...eeeeeeeee....hhhhhhhhhhhh...........eeeeeeeee....eeeeeeeee..hhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhhhhhhhhh.....eeeeeee...hhhhh..hhhhhhhhhhhh..eee........hhhhhhhhhhhh.
sequence :  ..ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
seq num:  ..19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |||||       | |                       ^**      | |  |  ||  || ||   |     || |                |  |       | | |^**             | |     ^**| || |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |||||       | |                                | |  |  ||  || ||   |     ^***                |  |       | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |||||       | |                                | |  |  ||  || ^*****      | |                |  |       | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..         ********       | |                                | |  |  ||  ||  |          | |                |  |       | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |||||       | |                                | |  *********  |          | |                |  |       | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |||||       | |                                | |  |  ||  ||  |          ***                |  |       | | |  |             | |     |  | || |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            |||||       | |                                | |  |  ||  ||  |                             |  |       | | |  |             | |     ******| |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |||||       | |                                | |  ********|  |                             |  |       | | |  |             | |        | || |          
search RasMol script viewer Motif-ligand binding stats  nest ..            *****       ***                                | |          |  |                             |  |       *** |  |             ***        ******          
search RasMol script viewer Motif-ligand binding stats  niche ..                                                           ***          ****                             ****           ****                                        

   New search    4kyi:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors