triangle PDBeMotif: 4kpe  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   5.99.1.3
Classification isomerase/dna/inhibitor    | release date: Mon, May 13, 2013
Title novel fluoroquinolones in complex with topoisomerase iv from pneumoniae and e-site g-gate
Authors A.S.WAGMAN, D.A.VESEKOV, H.E.MOS, I.LAPONOGOV, L.M.FISHER, M.R.SANDERSON, R.T.CIRZ, X.-S.PAN
Method X-RAY DIFFRACTION (resolution: 3.43Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search AF5 AF5 binding statistics AF5
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSS
IYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFP
NLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTD
LQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKAD
AKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKALEHHHHHH
Chains C,D sequence:
MGHHHHHHHHHHSSGHIDDDDKHMKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKV
INTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIAL
PPLYKMSKGKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVN
VLMGDKVEPRRKWIEDNVKFTLEEATVF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA TOPOISOMERASE 4 SUBUNIT A
member of: GENE3D:searchG3DSA_2.120.10.90/searchG3DSA_3.30.1360.40/searchG3DSA_3.90.199.10HAMAP:searchMF_00937PANTHER:searchPTHR10169/searchPTHR10169_SF20PFAM:searchPF00521SMART:searchSM00434SUPERFAMILY:searchSSF101904/searchSSF56719TIGRFAMS:searchTIGR01061UniProt:searchP72525
JMol viewer RasMol script viewer  AF5 101H  ..                                                                                                                  *                                                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  AF5 101F  ..                                                                            *                                     |                                                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  MG 701D  ..                                                                            |                                     |                                                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  MG 502A  ..                                                                            |                                     |                                                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  MG 501A  ..                                                                            |                                     |                                                                                                                                                                                                         *  *                                                                                                                                                                  
sec str:  ....eeeehhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhh........eehhhhhhhhhhhh...hhhhhhhhhhhh..........eeee.................eeeehhhhhhhhhhhhhh...eee......eee.......hhhhhhheeee....eeee...hhhhhhhhhhhhhhh...hhhhhh...........eeeehhhhhhhhhhhheeeeeee.eeeeee.....eeeeeee.....hhhhhhhhhhhhhhhh....eeeeee........eeeee....hhhhhhhhhhhhh..eeeeeee.eeee..eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeee.
sequence :  ..NIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSSIYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFPNLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRSKTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTDLQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKADAKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLSSLED
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   ^***||                |   | || |           | ||||  || ||| || |    | |     |  |   |  ||  |        ||^***|||   || ||  |   |  |||||||||||    | ||||||     | |     ^***| |  |                     | |||  |  |              | |       | |      |  |                |  |              ||||  |    | | |||    |  |  |        |   | ||     | |     | |    |   |         |   |  |                | || |     |  |             | |     | | ||   | || |                    |  |   |            |  || | |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | ||                |   | || |           | ||||  |^**|^**| |    | |     |  |   |  ||  |        || ||||||   || ||  |   |  |||||||||||    | ||^**|     | |         | |  |                     | ^**  |  |              | |       ^**      |  |                |  |              ||||  |    | ^**||    |  |  |        |   | ||     | |     ^**    |   |         |   |  |                | || |     |  |             | |     | | ||   | || |                    |  |   |            |  |^** |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^***                |   | || |           | ||||  |   |  || |    | |     ^***   |  ||  |        || ||||||   || ||  |   |  |||||||||||    | ||^***     | |         | |  |                     |  |   |  |              | |       | |      ^***                |  |              ||||  |    | ^***|    |  |  |        |   | ||     | |            |   |         |   ^***                | ^***     |  |             | |     | | ||   | ^***                    |  |   |            |  |  | ^*** 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     | |                 |   | || |           | ||||  |   |  || |    | |            |  ||  |        || ||||||   || ||  *******^||||||||||    | ||||       | |         | |  |                     |  |   |  |              | |       | |                          |  |              ||||  |    | |   |    |  |  |        |   | ||     | |            |   |         |   |                   |  |       |  |             | |     | | ||   |  |                      |  |   |            |  |  | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |                 |   | || |           | ||||  |   |  || ^***** |            |  ||  |        ^*****|||   || ||      |  |||||||||||    | ||||       | |         ^*****                     |  |   |  |              | |       | |                          |  |              ||||  |    | |   ^*****  |  |        |   | ||     | |            |   |         |   |                   |  |       |  |             | |     | | ||   |  |                      |  |   |            |  |  | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |                 |   | || |           | ||||  |   *****        |            |  ||  |         | || |||   || ||      *****|||||||||    | ||||       | |           |  |                     |  |   |  |              | |       | |                          |  |              ||||  |    | |           |  |        |   | ||     | |            |   |         |   |                   |  |       |  |             | |     | | ||   |  |                      |  |   |            |  |  | |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     | |                 |   | || |           | ||||  |   |  |         |            |  ||  |         | || |||   || ||      |  | |||||||||    | ||||       | |           |  |                     |  |   |  |              | |       | |                          |  |              ||||  |    | |           |  |        |   | ||     | |            |   |         |   |                   |  |       |  |             | |     | | ||   |  |                      |  *****            |  |  | |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |                 |   ******           | ||||  |   |  |         |            |  ||  |         ***| |||   || ||      |  | |||||||||    | ||||       | |           |  |                     |  |   |  |              | |       | |                          |  |              ||||  |    ***           |  |        |   | ||     | |            |   |         |   |                   |  |       |  |             | |     | | ||   |  |                      |  |                |  |  | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |                 |      | |           ****|****   ****         |            ****|  |            ****|   ****|      **** ****|||||    ****||       | |           |  |                     ****   ****              | |       | |                          ****              ||||  |    | |           |  |        |   | ||     | |            |   |         |   |                   ****       ****             | |     | | ||   |  |                      |  |                |  |  | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     | |                 |      | |             | ||  |                |            |  ||  |              | |    | ||         |  || |||||      ||||       | |           |  |                     |  |                     | |       | |                          |  |              ||||  |    | |           |  |        |   | ||     ***            |   |         |   |                              |  |             | |     | | ||   |  |                      |  |                |  |  | |    
search RasMol script viewer Motif-ligand binding stats  nest ..     | |                 |      ***             ***|  |                |            |  ||  |              ***    | ||         |  |*******      ****       ***           |  |                     |  |                     ***       ***                          |  |              ****  |    | |           |  |        |   | ||                    |   |         |   |                              |  |             ***     | | ||   |  |                      |  |                |  |  | |    
search RasMol script viewer Motif-ligand binding stats  niche ..     | |                 |                         ****                |            ********                     ****         ****                                      ****                     ****                               | |                          ****                 ****    ***           ****        |   ****                    |   |         |   |                              ****                     | ****   ****                      ****                ****  ***    
search RasMol script viewer Motif-ligand binding stats  ststaple ..     | |                 |                                             |                                           |                                                                                                                | |                                                                                 ***** |                     *****         *****                                                       *****                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..     ***                 |                                             |                                           |                                                                                                                ***                                                                                     ***                                                                                                                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                         *                                             *                                           *                                                                                                                                                                                                                                                                                                                                                                              

chain B : DNA TOPOISOMERASE 4 SUBUNIT A
member of: GENE3D:searchG3DSA_2.120.10.90/searchG3DSA_3.30.1360.40/searchG3DSA_3.90.199.10HAMAP:searchMF_00937PANTHER:searchPTHR10169/searchPTHR10169_SF20PFAM:searchPF00521SMART:searchSM00434SUPERFAMILY:searchSSF101904/searchSSF56719TIGRFAMS:searchTIGR01061UniProt:searchP72525
JMol viewer RasMol script viewer  AF5 101H  ..                                                                            *                                                                                                                                                                                                                                                                                                                                                                                                                     
JMol viewer RasMol script viewer  AF5 101F  ..                                                                            |                                     *                                                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  MG 502B  ..                                                                            |                                     |                                                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  MG 501B  ..                                                                            |                                     |                                                                                                                                                                                                         *  *                                                                                                                                                                  
sec str:  ....eeeehhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhh........eehhhhhhhhhhhh...hhhhhhhhhhhh..........eeee.................eeee..hhhhhhhhhhhh...eee......eee.......hhhhhhheeee....eeee...hhhhhhhhhhhhhhh...hhhhhh............eeehhhhhhhhhhhheeeeeee.eeeeee.hhh.eeeeeee.....hhhhhhhhhhhhhhh.....eeeeee........eeeee....hhhhhhhhhhhhh..eeeeeee.eeee..eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eee.
sequence :  ..NIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSSIYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFPNLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRSKTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTDLQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKADAKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLSSLED
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   ^***||                |   | || |           | ||||  || | | |  |   || |     |  |  || |||  |        ||^***| |    | ||  |   |  | |||||||||    | ||||||     | |     ^***| |  |       |   |         | |||  || |||    |  |              | |      |  |   |  |         |  ||   |      || ||||  |    | | |||    |  |  |        |   | ||     | |  |  | |    |   |         |   |  |                  |  |    ||  | | |         | |     | | || |  ||  |                    |  |                |  || | |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | ||                |   | || |           | ||||  |^** ^**  |   || |     |  |  || |||  |        || | || |    | ||  |   |  | |||||||||    | ||^**|     | |         | |  |       |   |         | ^**  || |||    |  |              ^**      |  |   |  |         |  ||   |      || ||||  |    | ^**||    |  |  |        |   | ||     | |  |  ^**    |   |         |   |  |                  |  |    ||  | | |         | |     | | || |  ||  |                    |  |                |  |^** |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ^***                |   | || |           | ||||  |         |   || |     ^***  || |||  |        || | || |    | ||  |   |  | |||||||||    | ||^***     | |         | |  |       |   |         |  |   || |||    |  |              | |      ^***   |  |         |  ||   |      || ||||  |    | ^***|    |  |  |        |   | ||     | |  |  |      |   |         |   ^***                  ^***    ||  | | |         | |     | | || |  |^***                    |  |                |  |  | ^*** 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     | |                 |   | || |           | ||||  |         |   || |           || |||  |        || | || |    | ||  *******^ |||||||||    | ||||       | |         | |  |       |   |         |  |   || |||    |  |              | |             |  |         |  ||   |      || ||||  |    | |   |    |  |  |        |   | ||     | |  |  |      |   |         |   |                             ||  | | |         | |     | | || |  |                        |  |                |  |  | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |                 |   | || |           | ||||  |         ^***** |           || |||  |        ^*****| |    | ||      |  | |||||||||    | ||||       | |         ^*****       |   |         |  |   || |||    |  |              | |             |  |         |  ||   |      || ||||  |    | |   ^*****  |  |        |   | ||     | |  |  |      |   |         |   |                             ||  | | |         | |     | | || |  |                        |  |                |  |  | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |                 |   | || |           | ||||  |             |  |           || |||  |         | |  | |    | ||      |  | |||||||||    | ||||       | |           |  |       |   |         |  |   |*****    |  |              | |             |  |         |  ||   |      || ||||  |    | |           |  |        |   | ||     | |  |  |      |   |         |   |                             ||  | | |         | |     | | || |  |                        |  |                |  |  | |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     | |                 |   | || |           | ||||  |             |  |           || |||  |         | |  | |    | ||      |  | |||||||||    | ||||       | |           |  |       *****         |  |   || ||     |  |              | |             |  |         |  |*****      || ||||  |    | |           |  |        |   | ||     | |  |  |      |   |         |   |                             ||  | | |         | |     | | || |  |                        |  |                |  |  | |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |                 |   ******           | ||||  |             |  |           || |||  |         ***  | |    | ||      |  | |||||||||    | ||||       | |           |  |                     |  |   || ||     |  |              | |             |  |         |  |           || ||||  |    ***           |  |        |   | ||     | |  |  |      |   |         |   |                             ||  | ***         | |     | | || |  |                        |  |                |  |  | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |                 |      | |           ****||  |             |  |           *****|  |              | |    | ||      **** ****|||||    ****||       | |           |  |                     |  |   *****     ****              | |             ****         ****           |****||  |    | |           |  |        |   | ||     | |  ****      |   |         |   |                             |****             | |     | **** ****                        |  |                |  |  | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     | |                 |      | |             | ||  |             |  |            |  ||  |              | |    | ||         |  || |||||      ||||       | |           |  |                     |  |                               | |                          |  |           |  ||||  |    | |           |  |        |   | ||     ***            |   |         |   |                             ||  |             | |     | | ||                             |  |                |  |  | |    
search RasMol script viewer Motif-ligand binding stats  nest ..     | |                 |      ***             ***|  |             |  |            |  ||  |              ***    | ||         |  |*******      ****       ***           |  |                     |  |                               ***                          |  |           |  ****  |    | |           |  |        |   | ||                    |   |         |   |                             ||  |             ***     | | ||                             |  |                |  |  | |    
search RasMol script viewer Motif-ligand binding stats  niche ..     | |                 |                         ****             ****            ********                     ****         ****                                      ****                     ****                               | |                          ****           |    |****    ***           ****        |   ****                    |   |         |   |                             |****                     | ****                             ****                ****  ***    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..     | |                 |                                             |                                           |                                                                                                                | |                                         ******                                  |   | |                     |   |         |   |                             |   |                     |   |                                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..     | |                 |                                             |                                           |                                                                                                                | |                                                                                 ***** |                     *****         *****                             *****                     *****                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..     ***                 |                                             |                                           |                                                                                                                ***                                                                                     ***                                                                                                                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                         *                                             *                                           *                                                                                                                                                                                                                                                                                                                                                                              

chain C : DNA TOPOISOMERASE 4 SUBUNIT B
member of: GENE3D:searchG3DSA_3.30.230.10/searchG3DSA_3.40.50.670HAMAP:searchMF_00939PANTHER:searchPTHR10169/searchPTHR10169_SF37PFAM:searchPF00204/searchPF00986/searchPF01751PRINTS:searchDNAGYRASEB/searchTPI2FAMILYPROSITE PATTERNS:searchPS00177, PROSITE PROFILES:searchPS50880, SMART:searchSM00433SUPERFAMILY:searchSSF54211/searchSSF56719TIGRFAMS:searchTIGR01058UniProt:searchQ59961
JMol viewer RasMol script viewer  AF5 101F  ..                                         *                  *                                                                     ..              ..                                                                
JMol viewer RasMol script viewer  MG 701C  ..                                         |                  |                                *                                    ..              ..                                                                
sec str:  ...............eeeeeehhhhhhhhhhhh....eeeeee..........hhhhhhhhhhhhhhhh..........hhhhh...eeeee...hhhhhhhhhhhhhhhhhhhhhhhhh..eeee............hhhhhhh...............hhhhhhhhhh......eeeee..hhhhhhhhhhhhhh.hhhhhhhhhhhhh...
sequence :  ..KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYK..AYAWTDGELEELRK..LQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
seq num:  ..415       425       435       445       455       465       475       485       495       505       515       525       535       ..556       566 ..577       587       597       607       617       627       637 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*   | |   | |   | |     |^**    |  |          |^**|    |  |         |||| || ||| ||        || |   |                   ||||         .. |  |  ||  || ..       | |   |   || || ||     |  | |       |  | |        |  |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   | |   | |   | |     |       |  |          ||| |    |  |         |||| || |^***|        ^***   |                   ||||         .. |  ^***|  || ..       | |   |   || || ||     ^*** |       |  | |        |  |  ^
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|   | |   | |   | |     |       |  |          ||| |    |  |         |||| || | |  |         | |   |                   ||||         ..*^      |  || ..       | |   |   || || ||        | |       |  | |        |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*   | |   | |   | |     |       |  |          ||| |    |  |         |^***** | |  |         | |   |                   ||||         ..        |  || ..       | |   |   || || ||        | |       |  | |        |  |   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    | |   | |   | |     |       |  |          ||| |    |  |         |||| |  | |  |         | |   |                   ||||         ..        |  || ..       | |   |   || || ||        | |       |  | |        |  |   
search RasMol script viewer Motif-ligand binding stats  TOPOISOMERASE_II ..    | |   | |   *********       |  |          ||| |    |  |         |||| |  | |  |         | |   |                   ||||         ..        |  || ..       | |   |   || || ||        | |       |  | |        |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |   | |     |             |  |          ||| |    |  |         |||| |  | |  |         | |   |                   ||||         ..        ***** ..       | |   |   || || ||        | |       |  | |        |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |   | |     |             |  |          ||| |    |  |         |||| |  | |  |         | *****                   ||||         ..        |  |  ..       | |   |   || || ||        | |       |  | |        |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |   | |     |             |  |          *** |    |  |         |||| |  | |  |         |                         ||||         ..        |  |  ..       | |   |   || || ||        ***       |  | |        |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |   | |     |             |  |           |  |    |  |         |||| |  | |  |         |                         ||||         ..        ****  ..       | |   |   || ****|                  |  | |        |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..    | |   | |     |             |  |           |  |    |  |         **** |  | |  |         |                         ****         ..              ..       | |   |   || ||  |                  |  | |        |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..    ***   ***     |             ****           ****    ****              **** ****         |                          ***         ..              ..       ***   |   |*******                  ******        ****   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  |                                                                        |                                      ..              ..             *****                                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                  *                                                                        *                                      ..              ..                                                                

chain D : DNA TOPOISOMERASE 4 SUBUNIT B
member of: GENE3D:searchG3DSA_3.30.230.10/searchG3DSA_3.40.50.670HAMAP:searchMF_00939PANTHER:searchPTHR10169/searchPTHR10169_SF37PFAM:searchPF00204/searchPF00986/searchPF01751PRINTS:searchDNAGYRASEB/searchTPI2FAMILYPROSITE PATTERNS:searchPS00177, PROSITE PROFILES:searchPS50880, SMART:searchSM00433SUPERFAMILY:searchSSF54211/searchSSF56719TIGRFAMS:searchTIGR01058UniProt:searchQ59961
JMol viewer RasMol script viewer  AF5 101H  ..                                         *                  *                                                                      ..               ..                                                                
JMol viewer RasMol script viewer  MG 701D  ..                                         |                  |                                *                                     ..               ..                                                                
sec str:  ...............eeeeeehhhhhhhhhhhh....eeeeee..........hhhhhhhhhhhhhhhhhhh..hhhhhhhhhh...eeeee...hhhhhhhhhhhhhhhhhhhhhhhh...eeee.............hhhhhhh...........hhhhhhhhhhhhhh.......eeeee....hhhhhhhhhhhh.hhhhhhhhhhhhh...
sequence :  ..KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKM..AYAWTDGELEELRKQ..LQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
seq num:  ..415       425       435       445       455       465       475       485       495       505       515       525       535        ..556       566  ..577       587       597       607       617       627       637 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*       | | |   | |     |^**   | |            |^**|    |  |  | ||| |||| ||||||| ||        || |   |             |  || ||||          .. |  |  ||  ||  ..      |  ||  ||  || ||  |     |  |         |  |          |  |  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|       | | |   | |     |      | |            ||| |    |  |  | ||| |||| |||||^***|        ^***   |             |  || ||||          .. |  ^***|  ||  ..      |  ||  ||  || ||  |     ^***         |  |          |  |  ^
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|       | | |   | |     |      | |            ||| |    |  |  | ||| |||| ||||| |  |         | |   |             |  || ||||          ..*^      |  ||  ..      |  ||  ||  || ||  |                  |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*       | | |   | |     |      | |            ||| |    |  |  | ||| ||^*****|| |  |         | |   |             |  || ||||          ..        |  ||  ..      |  ||  ||  || ||  |                  |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..        | | |   | |     |      | |            ||| |    |  |  | ||| || | || || |  |         | |   |             |  || ||||          ..        |  ||  ..      |  ||  ||  || ||  |                  |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  TOPOISOMERASE_II ..        | | |   *********      | |            ||| |    |  |  | ||| || | || || |  |         | |   |             |  || ||||          ..        |  ||  ..      |  ||  ||  || ||  |                  |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | | |     |            | |            ||| |    |  |  ***** || | || || |  |         | |   |             ***** ||||          ..        *****  ..      |  ||  ||  || ||  |                  |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        | | |     |            | |            ||| |    |  |  | ||  || | || || |  |         | *****             |  |  ||||          ..        |  |   ..      |  ||  ||  || ||  |                  |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | | |     |            ***            *** |    |  |  | ||  || | || || |  |         | |                 |  |  ||||          ..        |  |   ..      |  ||  ||  || ||  |                  |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | | |     |                            |  |    |  |  ****  || | ****| ****         | |                 ****  ||||          ..        ****   ..      |  |****|  || ||  |                  |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        *** |     |                            |  |    |  |    |   || |  |  | |  |         | |                       ||||          ..               ..      |  |   ||  || ||  |                  |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..          | |     |                            |  |    |  |    |   |***  |  | |  |         | |                       ****          ..               ..      |  |   ||  || ||  |                  |  |          |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..          ***     |                            ****    ****    |   |     **** ****         ***                        ***          ..               ..      ****   ||  |*******                  ****          ****   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  |                                            *****                       |                                       ..               ..             ******                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                  *                                                                        *                                       ..               ..                                                                

chain E : E-SITE DNA1
JMol viewer RasMol script viewer  AF5 101F  ..      *
JMol viewer RasMol script viewer  MG 701C  ..      |
JMol viewer RasMol script viewer  MG 502A  ..      |
sec str:  .........
sequence :  ..CATGAAT
seq num:  ..9      

chain F : E-SITE DNA2
JMol viewer RasMol script viewer  AF5 101H  ..*          
JMol viewer RasMol script viewer  AF5 101F  ..|  **      
JMol viewer RasMol script viewer  MG 502B  ..|  ||      
sec str:  .............
sequence :  ..AGTCATTCATG
seq num:  ..1          

chain G : E-SITE DNA3
JMol viewer RasMol script viewer  AF5 101H  ..      *
JMol viewer RasMol script viewer  MG 701D  ..      |
JMol viewer RasMol script viewer  MG 502B  ..      |
sec str:  .........
sequence :  ..CGTGCAT
seq num:  ..9      

chain H : E-SITE DNA4
JMol viewer RasMol script viewer  AF5 101H  ..   **      
JMol viewer RasMol script viewer  AF5 101F  ..*  ||      
JMol viewer RasMol script viewer  MG 502B  ..|  ||      
JMol viewer RasMol script viewer  MG 502A  ..|  ||      
sec str:  .............
sequence :  ..GACTATGCACG
seq num:  ..1          

   New search    4kpe:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors